cDNA Clone - SND1

Name: SND1
Price per aliquot: £110.00
Expressed:
HA SND1
Plasmid:
pCMV5-HA SND1
Parent Plasmid:
pCMV5 HA1
View Parent Plasmid

Snapgene File | Genbank File
cccattcgccattcaggctgcgcaactgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggggatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacgacggccagtgccaagctgatctatacattgaatcaatattggcaattagccatattagtcattggttatatagcataaatcaatattggctattggccattgcatacgttgtatctatatcataatatgtacatttatattggctcatgtccaatatgaccgccatgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacaccaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccgtcagaaATTGGCCACCATGTACCCATACGATGTGCCAGATTACGCCGGATCCCCGGAATTCCCGGGTCGACTCGAGCGGCCGCGATCCCGGGtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaacctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggctcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgttgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggggtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccaccttggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctgattttaaaataactataccagcaggaggacgtccagacacagcataggctacctgccatggcccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtccactcagtagatgcctgttgaattgggtacgcggccagcttctgtggaatgtgtgtcagttagggtgtggaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccaggtgtggaaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccatagtcccgcccctaactccgcccatcccgcccctaactccgcccagttccgcccattctccgccccatggctgactaattttttttatttatgcagaggccgaggccgcctcggcctctgagctattccagaagtagtgaggaggcttttttggaggcctaggcttttgcaaaaagctcctcgaggaactgaaaaaccagaaagttaattccctatagtgagtcgtattaaattcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaaggacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcggggcatccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtagtgggccatcgccctgatagacggtttttcgccctttgacgttggagtccacgttctttaatagtggactcttgttccaaactggaacaacactcaaccctatctcggtctattcttttgatttataagggattttgccgatttcggcctattggttaaaaaatgagctgatttaacaaaaatttaacgcgaattttaacaaaatattaacaaaatattaacgtttacaatttc
DU Number:
DU31248
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGGCGTCCTCCGCGCAGAGCGGCGGCTCCTCCGGGGGACCCGC GGTCCCCACCGTGCAGCGGGGCATCATCAAGATGGTCCTCTCAGGGTGCG CCATCATTGTCCGAGGTCAGCCTCGTGGTGGGCCTCCTCCTGAGCGGCAG ATCAACCTCAGCAACATTCGTGCTGGAAATCTTGCTCGCCGGGCAGCCGC CACACAACCTGATGCAAAGGATACCCCTGATGAGCCCTGGGCATTTCCAG CTCGAGAGTTCCTTCGAAAGAAGCTGATTGGGAAGGAAGTCTGTTTCACG ATAGAAAACAAGACTCCCCAGGGGCGAGAGTATGGCATGATCTACCTTGG AAAAGATACCAATGGGGAAAACATTGCAGAATCACTGGTTGCAGAGGGCT TAGCCACCCGGAGAGAAGGCATGAGAGCTAATAATCCTGAGCAGAACCGG CTTTCAGAATGTGAAGAACAAGCAAAGGCAGCCAAGAAAGGGATGTGGAG TGAGGGGAACGGTTCACATACTATCCGGGATCTCAAGTATACCATTGAAA ACCCAAGGCACTTTGTGGACTCACACCACCAGAAGCCTGTTAATGCTATC ATCGAGCATGTGCGGGACGGCAGTGTGGTCAGGGCCCTGCTCCTCCCAGA TTACTACCTGGTTACAGTCATGCTGTCAGGCATCAAGTGCCCAACTTTTC GACGGGAAGCAGATGGCAGTGAAACTCCAGAGCCTTTTGCTGCAGAAGCC AAATTTTTCACTGAGTCGCGACTGCTTCAGAGAGATGTTCAGATCATTCT GGAGAGCTGCCACAACCAGAACATTCTGGGTACCATCCTTCATCCAAATG GCAACATCACAGAGCTCCTCCTGAAGGAAGGTTTCGCACGCTGTGTGGAC TGGTCGATTGCAGTTTACACCCGGGGCGCAGAAAAGCTGAGGGCGGCAGA GAGGTTTGCCAAAGAGCGCAGGCTGAGAATATGGAGAGACTATGTGGCTC CCACAGCTAATTTGGACCAAAAGGACAAGCAGTTTGTTGCCAAGGTGATG CAGGTTCTGAATGCTGATGCCATTGTTGTGAAGCTGAACTCAGGCGATTA CAAGACGATTCACCTGTCCAGCATCCGACCACCGAGGCTGGAGGGGGAGA ACACCCAGGATAAGAACAAGAAACTGCGTCCCCTGTATGACATTCCTTAC ATGTTTGAGGCCCGGGAATTTCTTCGAAAAAAGCTTATTGGGAAGAAGGT CAATGTGACGGTGGACTACATTAGACCAGCCAGCCCAGCCACAGAGACAG TGCCTGCCTTTTCAGAGCGTACCTGTGCCACTGTCACCATTGGAGGAATA AACATTGCTGAGGCTCTTGTCAGCAAAGGTCTAGCCACAGTGATCAGATA CCGGCAGGATGATGACCAGAGATCATCACACTACGATGAACTGCTTGCTG CAGAGGCCAGAGCTATTAAGAATGGCAAAGGATTGCATAGCAAGAAGGAA GTGCCTATCCACCGTGTTGCAGATATATCTGGGGATACCCAAAAAGCAAA GCAGTTCCTGCCTTTTCTTCAGCGGGCAGGTCGTTCTGAAGCTGTGGTGG AATACGTCTTCAGTGGTTCTCGTCTCAAACTCTATTTGCCAAAGGAAACT TGCCTTATCACCTTCTTGCTTGCAGGCATTGAATGCCCCAGAGGAGCCCG AAACCTCCCAGGCTTGGTGCAGGAAGGAGAGCCCTTCAGCGAGGAAGCTA CACTTTTCACCAAGGAACTGGTGCTGCAGCGAGAGGTGGAGGTGGAGGTG GAGAGCATGGACAAGGCCGGCAACTTTATCGGCTGGCTGCACATCGACGG TGCCAACCTGTCCGTCCTGCTGGTGGAGCACGCGCTCTCCAAGGTCCACT TCACCGCCGAACGCAGCTCCTACTACAAGTCCCTGCTGTCTGCCGAGGAG GCCGCAAAGCAGAAGAAAGAGAAGGTCTGGGCCCACTATGAGGAGCAGCC CGTGGAGGAGGTGATGCCAGTGCTGGAGGAGAAGGAGCGATCTGCTAGCT ACAAGCCCGTGTTTGTGACCGAGATCACTGATGACCTGCACTTCTACGTG CAGGATGTGGAGACCGGCACCCAGTTGGAGAAGCTGATGGAGAACATGCG CAATGACATTGCCAGTCACCCCCCTGTAGAGGGCTCCTATGCCCCCCGCA GGGGAGAGTTCTGCATTGCCAAATTTGTAGATGGAGAATGGTACCGTGCC CGAGTAGAGAAAGTCGAGTCTCCTGCCAAAATACATGTCTTCTACATTGA CTACGGCAACAGAGAGGTCCTGCCATCCACCCGCCTGGGTACCCTATCAC CTGCCTTCAGCACTCGGGTGCTGCCAGCTCAAGCCACGGAGTATGCCTTC GCCTTCATCCAGGTGCCCCAAGATGATGATGCCCGCACGGACGCCGTGGA CAGCGTAGTTCGGGATATCCAGAACACTCAGTGCCTGCTCAACGTGGAAC ACCTGAGTGCCGGCTGCCCCCATGTCACCCTGCAGTTTGCAGATTCCAAG GGCGATGTGGGGCTGGGCTTGGTGAAGGAAGGGCTGGTCATGGTGGAGGT GCGCAAGGAGAAACAGTTCCAGAAAGTGATCACAGAATACCTGAATGCCC AAGAGTCAGCCAAGAGCGCCAGGCTGAACCTGTGGCGCTATGGAGACTTT CGAGCTGATGATGCAGACGAATTTGGCTACAGCCGCTAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGSMASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQ PRGGPPPERQINLSNIRAGNLARRAAATQPDAKDTPDEPWAFPAREFLRK KLIGKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREG MRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVD SHHQKPVNAIIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGS ETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELL LKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQ KDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGENTQDKNK KLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSER TCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIK NGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGS RLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL VLQREVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSS YYKSLLSAEEAAKQKKEKVWAHYEEQPVEEVMPVLEEKERSASYKPVFVT EITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIA KFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRV LPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCP HVTLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSA RLNLWRYGDFRADDADEFGYSR*
Antibiotic:
Amp
Comments:
*Sequence difference compared with NM_014390.2 CDS: t2064c (silent) Estimated MW of expressed protein : 103351 Daltons

Do you need any help? Please get in touch and we’ll be happy to lend a hand.