cDNA Clone - 53BP1

Name: 53BP1
Price per aliquot: £110.00
Expressed:
HA-53BP1
Plasmid:
pHR-SIN-CSGW HA.h53BP1 (lent)
Parent Plasmid:
pHR SIN CSGW
View Parent Plasmid

|
DU Number:
DU5709
Genbank:
Species:
Human
Synonyms:
TP53BP1
Sequence of Insert:
View Sequence

ACTAGTGCCACCATGTACCCATACGATGTGCCAGATTACGCCATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGG TTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGA AGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATAC TTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACT TCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAG AGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATT CCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAAT AGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAA ATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTT CCTTACCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTG CAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTC AAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGC TGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGT GAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACC ATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCA AGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATA GCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCCCAT ACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATA AATTATGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAA GAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAA TGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGT CTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGT GAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAG TTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCA GGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTT TCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCAAGG AGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTA CTAATAAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAAT AACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGT TTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTA CAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGG GGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCT CCATAGCCAGGGAGAAGAAGAGTTTGATATGCCTCAGCCTCCACATGGCC ATGTCTTACATCGTCACATGAGAACAATCCGGGAAGTACGCACACTTGTC ACTCGTGTCATTACAGATGTGTATTATGTGGATGGAACAGAAGTAGAAAG AAAAGTAACTGAGGAGACTGAAGAGCCAATTGTAGAGTGTCAGGAGTGTG AAACTGAAGTTTCCCCTTCACAGACTGGGGGCTCCTCAGGTGACCTGGGG GATATCAGCTCCTTCTCCTCCAAGGCATCCAGCTTACACCGCACATCAAG TGGGACAAGTCTCTCAGCTATGCACAGCAGTGGAAGCTCAGGGAAAGGAG CCGGACCACTCAGAGGGAAAACCAGCGGGACAGAACCCGCAGATTTTGCC TTACCCAGCTCCCGAGGAGGCCCAGGAAAACTGAGTCCTAGAAAAGGGGT CAGTCAGACAGGGACGCCAGTGTGTGAGGAGGATGGTGATGCAGGCCTTG GCATCAGACAGGGAGGGAAGGCTCCAGTCACGCCTCGTGGGCGTGGGCGA AGGGGCCGCCCACCTTCTCGGACCACTGGAACCAGAGAAACAGCTGTGCC TGGCCCCTTGGGCATAGAGGACATTTCACCTAACTTGTCACCAGATGATA AATCCTTCAGCCGTGTCGTGCCCCGAGTGCCAGACTCCACCAGACGAACA GATGTGGGTGCTGGTGCTTTGCGTCGTAGTGACTCTCCAGAAATTCCTTT CCAGGCTGCTGCTGGCCCTTCTGATGGCTTAGATGCCTCCTCTCCAGGAA ATAGCTTTGTAGGGCTCCGTGTTGTAGCCAAGTGGTCATCCAATGGCTAC TTTTACTCTGGGAAAATCACACGAGATGTCGGAGCTGGGAAGTATAAATT GCTCTTTGATGATGGGTACGAATGTGATGTGTTGGGCAAAGACATTCTGT TATGTGACCCCATCCCGCTGGACACTGAAGTGACGGCCCTCTCGGAGGAT GAGTATTTCAGTGCAGGAGTGGTGAAAGGACATAGGAAGGAGTCTGGGGA ACTGTACTACAGCATTGAAAAAGAAGGCCAAAGAAAGTGGTATAAGCGAA TGGCTGTCATCCTGTCCTTGGAGCAAGGAAACAGACTGAGAGAGCAGTAT GGGCTTGGCCCCTATGAAGCAGTAACACCTCTTACAAAGGCAGCAGATAT CAGCTTAGACAATTTGGTGGAAGGGAAGCGGAAACGGCGCAGTAACGTCA GCTCCCCAGCCACCCCTACTGCCTCCAGTAGCAGCAGCACAACCCCTACC CGAAAGATCACAGAAAGTCCTCGTGCCTCCATGGGAGTTCTCTCAGGCAA AAGAAAACTTATCACTTCTGAAGAGGAACGGTCCCCTGCCAAGCGAGGTC GCAAGTCTGCCACAGTAAAACCTGGTGCAGTAGGGGCAGGAGAGTTTGTG AGCCCCTGTGAGAGTGGAGACAACACCGGTGAACCCTCTGCCCTGGAAGA GCAGAGAGGGCCTTTGCCTCTCAACAAGACCTTGTTTCTGGGCTACGCAT TTCTCCTTACCATGGCCACAACCAGTGACAAGTTGGCCAGCCGCTCCAAA CTGCCAGATGGTCCTACAGGAAGCAGTGAAGAAGAGGAGGAATTTTTGGA AATTCCTCCTTTCAACAAGCAGTATACAGAATCCCAGCTTCGAGCAGGAG CTGGCTATATCCTTGAAGATTTCAATGAAGCCCAGTGTAACACAGCTTAC CAGTGTCTTCTAATTGCGGATCAGCATTGTCGAACCCGGAAGTACTTCCT GTGCCTTGCCAGTGGGATTCCTTGTGTGTCTCATGTCTGGGTCCATGATA GTTGCCATGCCAACCAGCTCCAGAACTACCGTAATTATCTGTTGCCAGCT GGGTACAGCCTTGAGGAGCAAAGAATTCTGGACTGGCAACCCCGTGAAAA TCCTTTCCAGAATCTGAAGGTACTCTTGGTATCAGACCAACAGCAGAACT TCCTGGAGCTCTGGTCTGAGATCCTCATGACTGGTGGTGCAGCCTCTGTG AAGCAGCACCATTCAAGTGCCCATAACAAAGATATTGCTTTAGGGGTATT TGATGTGGTGGTGACGGACCCCTCATGCCCAGCCTCGGTGCTGAAGTGTG CTGAAGCATTGCAGCTGCCTGTGGTGTCACAAGAGTGGGTGATCCAGTGC CTCATTGTTGGGGAGAGAATTGGATTCAAGCAGCATCCAAAATATAAACA CGATTATGTTTCTCACTAAAGCGCT
Amino Acid Sequence:
View Sequence

MYPYDVPDYAMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHF SMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVA DPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELE QKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQDVEENTVPYEV DKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTA QPSKDVHVVKEQNPPPARSEDMPFSPKASVAAMEAKEQLSAQELMESGLQ IQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLH LLQLSGQRSLVQDSLSTNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDK PMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQST PVFPPGSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECS KTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDG ENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDD TDTRDDISILATGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEALSS VLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLH LSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLAILDQELEH KEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDI APEIEPCAENRLDTKEEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRA DDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAH ASQSFCESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPI GISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCLRMK LVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCIC EARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGDHTIRQSQQPM KPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPS KALIERPSQNNIGIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQNFG KQDATVQTERGSGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRHM RTIREVRTLVTRVITDVYYVDGTEVERKVTEETEEPIVECQECETEVSPS QTGGSSGDLGDISSFSSKASSLHRTSSGTSLSAMHSSGSSGKGAGPLRGK TSGTEPADFALPSSRGGPGKLSPRKGVSQTGTPVCEEDGDAGLGIRQGGK APVTPRGRGRRGRPPSRTTGTRETAVPGPLGIEDISPNLSPDDKSFSRVV PRVPDSTRRTDVGAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLR VVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPL DTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSL EQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSNVSSPATPT ASSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPAKRGRKSATVK PGAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMAT TSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILED FNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQL QNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSE ILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLP VVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH*
Antibiotic:
Amp
Comments:
Plasmid for lentiviral expression in mammalian cells (SFFV promoter)

Do you need any help? Please get in touch and we’ll be happy to lend a hand.