cDNA Clone - 53BP1

Name: 53BP1
Price per aliquot: £110.00
Expressed:
GFP-TAP HA-53BP1
Plasmid:
pGFP-TAP-BN HA.53BP1
Parent Plasmid:
pGFP TAP BN
View Parent Plasmid

Snapgene File | Genbank File
TAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCG CCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGT AAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTA CATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGA TAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTA ACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTGGTTTAGTGAACCGTCAGATCCGCTAGCGCTA CCGGTCGCCACCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCG TGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGAC CACCCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAG CGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCG ACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAA GGTGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTG CCCGACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGA TCACTCTCGGCATGGACGAGCTGTACAAGTCCGGCCGGACTCAGATCTCGAGCTCAAGCTTCGATATCGCCCTTGCCACCATGGACACAAGTGCCCACGA TGAAGCCGTAGACAACAAATTCAACAAAGAACAACAAAACGCGTTCTATGAGATCTTACATTTACCTAACTTAAACGAAGAACAACGAAACGCCTTCATC CAAAGTTTAAAAGATGACCCAAGCCAAAGCGCTAACCTTTTAGCAGAAGCTAAAAAGCTAAATGATGCTCAGGCGCCGAAAGTAGACAACAAATTCAACA AAGAACGACAAAACGCGTTCTATGAGATCTTACATTTACCTAACTTAAACGAAGAACAACGAAACGCCTTCATCCAAAGTTTAAAAGATGACCCAAGCCA AAGCGCTAACCTTTTAGCAGAAGCTAAAAAGCTAAATGATGCTCAGGCGCCGAAAGTAGACGCGAGTTGGTCAGCGGGTGCTAGCGAGAACTTGTACTTC CAGGGCGGAAGATCGATGGAAAAGAGAAGATGGAAAAAGAATTTCATAGCCGTCTCAGCAGCCAACCGCTTTAAGAAAATCTCATCCTCCGGGGCACTTG ATTATGATATTCCAACTGCTCTGGAAGTTCTGTTCCAGGGGCCCCTGGGATCCAGATCTGGTACCGCGGCCGCAAGGGCGAATTCTGCAGTCGACGGTAC CGCGGGCCCGGTATCGACCGGATCTAGATAACTGATCATAATCAGCCATACCACATTTGTAGAGGTTTTACTTGCTTTAAAAAACCTCCCACACCTCCCC CTGAACCTGAAACATAAAATGAATGCAATTGTTGTTGTTAACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAATTTCACAA ATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTAACGCGTAAATTGTAAGCGTTAATATTTTGTTAAAATTCG CGTTAAATTTTTGTTAAATCAGCTCATTTTTTAACCAATAGGCCGAAATCGGCAAAATCCCTTATAAATCAAAAGAATAGACCGAGATAGGGTTGAGTGT TGTTCCAGTTTGGAACAAGAGTCCACTATTAAAGAACGTGGACTCCAACGTCAAAGGGCGAAAAACCGTCTATCAGGGCGATGGCCCACTACGTGAACCA TCACCCTAATCAAGTTTTTTGGGGTCGAGGTGCCGTAAAGCACTAAATCGGAACCCTAAAGGGAGCCCCCGATTTAGAGCTTGACGGGGAAAGCCGGCGA ACGTGGCGAGAAAGGAAGGGAAGAAAGCGAAAGGAGCGGGCGCTAGGGCGCTGGCAAGTGTAGCGGTCACGCTGCGCGTAACCACCACACCCGCCGCGCT TAATGCGCCGCTACAGGGCGCGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCG CTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTCCTGAGGCGGAAAGAACCAGCTGTGGAATGTGTGTCAGTTAGGGTG TGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCAGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGC AGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCATAGTCCCGCCCCTAACTCCGCCCATCCCGCCCCTAACTCCGCCCAGTTCCGCCCATTCTC CGCCCCATGGCTGACTAATTTTTTTTATTTATGCAGAGGCCGAGGCCGCCTCGGCCTCTGAGCTATTCCAGAAGTAGTGAGGAGGCTTTTTTGGAGGCCT AGGCTTTTGCAAAGATCGATCAAGAGACAGGATGAGGATCGTTTCGCATGATTGAACAAGATGGATTGCACGCAGGTTCTCCGGCCGCTTGGGTGGAGAG GCTATTCGGCTATGACTGGGCACAACAGACAATCGGCTGCTCTGATGCCGCCGTGTTCCGGCTGTCAGCGCAGGGGCGCCCGGTTCTTTTTGTCAAGACC GACCTGTCCGGTGCCCTGAATGAACTGCAAGACGAGGCAGCGCGGCTATCGTGGCTGGCCACGACGGGCGTTCCTTGCGCAGCTGTGCTCGACGTTGTCA CTGAAGCGGGAAGGGACTGGCTGCTATTGGGCGAAGTGCCGGGGCAGGATCTCCTGTCATCTCACCTTGCTCCTGCCGAGAAAGTATCCATCATGGCTGA TGCAATGCGGCGGCTGCATACGCTTGATCCGGCTACCTGCCCATTCGACCACCAAGCGAAACATCGCATCGAGCGAGCACGTACTCGGATGGAAGCCGGT CTTGTCGATCAGGATGATCTGGACGAAGAGCATCAGGGGCTCGCGCCAGCCGAACTGTTCGCCAGGCTCAAGGCGAGCATGCCCGACGGCGAGGATCTCG TCGTGACCCATGGCGATGCCTGCTTGCCGAATATCATGGTGGAAAATGGCCGCTTTTCTGGATTCATCGACTGTGGCCGGCTGGGTGTGGCGGACCGCTA TCAGGACATAGCGTTGGCTACCCGTGATATTGCTGAAGAGCTTGGCGGCGAATGGGCTGACCGCTTCCTCGTGCTTTACGGTATCGCCGCTCCCGATTCG CAGCGCATCGCCTTCTATCGCCTTCTTGACGAGTTCTTCTGAGCGGGACTCTGGGGTTCGAAATGACCGACCAAGCGACGCCCAACCTGCCATCACGAGA TTTCGATTCCACCGCCGCCTTCTATGAAAGGTTGGGCTTCGGAATCGTTTTCCGGGACGCCGGCTGGATGATCCTCCAGCGCGGGGATCTCATGCTGGAG TTCTTCGCCCACCCTAGGGGGAGGCTAACTGAAACACGGAAGGAGACAATACCGGAAGGAACCCGCGCTATGACGGCAATAAAAAGACAGAATAAAACGC ACGGTGTTGGGTCGTTTGTTCATAAACGCGGGGTTCGGTCCCAGGGCTGGCACTCTGTCGATACCCCACCGAGACCCCATTGGGGCCAATACGCCCGCGT TTCTTCCTTTTCCCCACCCCACCCCCCAAGTTCGGGTGAAGGCCCAGGGCTCGCAGCCAACGTCGGGGCGGCAGGCCCTGCCATAGCCTCAGGTTACTCA TATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGT TTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACC ACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTT CTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCG ATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGA GCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGC AGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGAT TTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTT CTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCATGCAT
DU Number:
DU5511
Genbank:
Species:
Human
Synonyms:
TP53BP1
Sequence of Insert:
View Sequence

ggtaccGCCACCATGTACCCATACGATGTGCCAGATTACGCCATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGG TTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGA AGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATAC TTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACT TCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAG AGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATT CCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAAT AGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAA ATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTT CCTTACCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTG CAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTC AAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGC TGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGT GAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACC ATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCA AGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATA GCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCCCAT ACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATA AATTATGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAA GAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAA TGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGT CTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGT GAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAG TTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCA GGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTT TCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCAAGG AGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTA CTAATAAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAAT AACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGT TTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTA CAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGG GGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCT CCATAGCCAGGGAGAAGAAGAGTTTGATATGCCTCAGCCTCCACATGGCC ATGTCTTACATCGTCACATGAGAACAATCCGGGAAGTACGCACACTTGTC ACTCGTGTCATTACAGATGTGTATTATGTGGATGGAACAGAAGTAGAAAG AAAAGTAACTGAGGAGACTGAAGAGCCAATTGTAGAGTGTCAGGAGTGTG AAACTGAAGTTTCCCCTTCACAGACTGGGGGCTCCTCAGGTGACCTGGGG GATATCAGCTCCTTCTCCTCCAAGGCATCCAGCTTACACCGCACATCAAG TGGGACAAGTCTCTCAGCTATGCACAGCAGTGGAAGCTCAGGGAAAGGAG CCGGACCACTCAGAGGGAAAACCAGCGGGACAGAACCCGCAGATTTTGCC TTACCCAGCTCCCGAGGAGGCCCAGGAAAACTGAGTCCTAGAAAAGGGGT CAGTCAGACAGGGACGCCAGTGTGTGAGGAGGATGGTGATGCAGGCCTTG GCATCAGACAGGGAGGGAAGGCTCCAGTCACGCCTCGTGGGCGTGGGCGA AGGGGCCGCCCACCTTCTCGGACCACTGGAACCAGAGAAACAGCTGTGCC TGGCCCCTTGGGCATAGAGGACATTTCACCTAACTTGTCACCAGATGATA AATCCTTCAGCCGTGTCGTGCCCCGAGTGCCAGACTCCACCAGACGAACA GATGTGGGTGCTGGTGCTTTGCGTCGTAGTGACTCTCCAGAAATTCCTTT CCAGGCTGCTGCTGGCCCTTCTGATGGCTTAGATGCCTCCTCTCCAGGAA ATAGCTTTGTAGGGCTCCGTGTTGTAGCCAAGTGGTCATCCAATGGCTAC TTTTACTCTGGGAAAATCACACGAGATGTCGGAGCTGGGAAGTATAAATT GCTCTTTGATGATGGGTACGAATGTGATGTGTTGGGCAAAGACATTCTGT TATGTGACCCCATCCCGCTGGACACTGAAGTGACGGCCCTCTCGGAGGAT GAGTATTTCAGTGCAGGAGTGGTGAAAGGACATAGGAAGGAGTCTGGGGA ACTGTACTACAGCATTGAAAAAGAAGGCCAAAGAAAGTGGTATAAGCGAA TGGCTGTCATCCTGTCCTTGGAGCAAGGAAACAGACTGAGAGAGCAGTAT GGGCTTGGCCCCTATGAAGCAGTAACACCTCTTACAAAGGCAGCAGATAT CAGCTTAGACAATTTGGTGGAAGGGAAGCGGAAACGGCGCAGTAACGTCA GCTCCCCAGCCACCCCTACTGCCTCCAGTAGCAGCAGCACAACCCCTACC CGAAAGATCACAGAAAGTCCTCGTGCCTCCATGGGAGTTCTCTCAGGCAA AAGAAAACTTATCACTTCTGAAGAGGAACGGTCCCCTGCCAAGCGAGGTC GCAAGTCTGCCACAGTAAAACCTGGTGCAGTAGGGGCAGGAGAGTTTGTG AGCCCCTGTGAGAGTGGAGACAACACCGGTGAACCCTCTGCCCTGGAAGA GCAGAGAGGGCCTTTGCCTCTCAACAAGACCTTGTTTCTGGGCTACGCAT TTCTCCTTACCATGGCCACAACCAGTGACAAGTTGGCCAGCCGCTCCAAA CTGCCAGATGGTCCTACAGGAAGCAGTGAAGAAGAGGAGGAATTTTTGGA AATTCCTCCTTTCAACAAGCAGTATACAGAATCCCAGCTTCGAGCAGGAG CTGGCTATATCCTTGAAGATTTCAATGAAGCCCAGTGTAACACAGCTTAC CAGTGTCTTCTAATTGCGGATCAGCATTGTCGAACCCGGAAGTACTTCCT GTGCCTTGCCAGTGGGATTCCTTGTGTGTCTCATGTCTGGGTCCATGATA GTTGCCATGCCAACCAGCTCCAGAACTACCGTAATTATCTGTTGCCAGCT GGGTACAGCCTTGAGGAGCAAAGAATTCTGGACTGGCAACCCCGTGAAAA TCCTTTCCAGAATCTGAAGGTACTCTTGGTATCAGACCAACAGCAGAACT TCCTGGAGCTCTGGTCTGAGATCCTCATGACTGGTGGTGCAGCCTCTGTG AAGCAGCACCATTCAAGTGCCCATAACAAAGATATTGCTTTAGGGGTATT TGATGTGGTGGTGACGGACCCCTCATGCCCAGCCTCGGTGCTGAAGTGTG CTGAAGCATTGCAGCTGCCTGTGGTGTCACAAGAGTGGGTGATCCAGTGC CTCATTGTTGGGGAGAGAATTGGATTCAAGCAGCATCCAAAATATAAACA CGATTATGTTTCTCACTAAggtacc
Amino Acid Sequence:
View Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGRTQISSSSF DIALATMDTSAHDEAVDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLK DDPSQSANLLAEAKKLNDAQAPKVDNKFNKERQNAFYEILHLPNLNEEQR NAFIQSLKDDPSQSANLLAEAKKLNDAQAPKVDASWSAGASENLYFQGGR SMEKRRWKKNFIAVSAANRFKKISSSGALDYDIPTALEVLFQGPLGSRSG TATMYPYDVPDYAMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSG SHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKEN KVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGE ELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQDVEENTVP YEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIP VTAQPSKDVHVVKEQNPPPARSEDMPFSPKASVAAMEAKEQLSAQELMES GLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPAT TLHLLQLSGQRSLVQDSLSTNSSDLVAPSPDAFRSTPFIVPSSPTEQEGR QDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPIS QSTPVFPPGSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTV ECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRID EDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTK GDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEA LSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESV PLHLSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLAILDQE LEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSW EDIAPEIEPCAENRLDTKEEKSVEYEGDLKSGTAETEPVEQDSSQPSLPL VRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKP SAHASQSFCESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHS TPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCL RMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLS CICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGDHTIRQSQ QPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKE NPSKALIERPSQNNIGIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQ NFGKQDATVQTERGSGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLH RHMRTIREVRTLVTRVITDVYYVDGTEVERKVTEETEEPIVECQECETEV SPSQTGGSSGDLGDISSFSSKASSLHRTSSGTSLSAMHSSGSSGKGAGPL RGKTSGTEPADFALPSSRGGPGKLSPRKGVSQTGTPVCEEDGDAGLGIRQ GGKAPVTPRGRGRRGRPPSRTTGTRETAVPGPLGIEDISPNLSPDDKSFS RVVPRVPDSTRRTDVGAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFV GLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDP IPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVI LSLEQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSNVSSPA TPTASSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPAKRGRKSA TVKPGAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLT MATTSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYI LEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHA NQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLEL WSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL QLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH*
Antibiotic:
Kan

Do you need any help? Please get in touch and we’ll be happy to lend a hand.