cDNA Clone - 53BP1

Name: 53BP1
Price per aliquot: £110.00
Expressed:
HA-53BP1 2-1691-PDGFB 528-1106(end)
Plasmid:
pCMV5-HA 53BP1 2-1691-PDGFB 528-1106(end)
Parent Plasmid:
pCMV5
View Parent Plasmid

Snapgene File | Genbank File
cccattcgccattcaggctgcgcaactgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggggatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacgacggccagtgccaagctgatctatacattgaatcaatattggcaattagccatattagtcattggttatatagcataaatcaatattggctattggccattgcatacgttgtatctatatcataatatgtacatttatattggctcatgtccaatatgaccgccatgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacaccaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccgtcagaattcagatctggtaccacgcgtatcgataagcttgcatgcctgcaggtcgactctagaggatcccgggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaacctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggctcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgttgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggggtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccaccttggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctgattttaaaataactataccagcaggaggacgtccagacacagcataggctacctgccatggcccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtccactcagtagatgcctgttgaattgggtacgcggccagcttctgtggaatgtgtgtcagttagggtgtggaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccaggtgtggaaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccatagtcccgcccctaactccgcccatcccgcccctaactccgcccagttccgcccattctccgccccatggctgactaattttttttatttatgcagaggccgaggccgcctcggcctctgagctattccagaagtagtgaggaggcttttttggaggcctaggcttttgcaaaaagctcctcgaggaactgaaaaaccagaaagttaattccctatagtgagtcgtattaaattcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaaggacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcggggcatccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtagtgggccatcgccctgatagacggtttttcgccctttgacgttggagtccacgttctttaatagtggactcttgttccaaactggaacaacactcaaccctatctcggtctattcttttgatttataagggattttgccgatttcggcctattggttaaaaaatgagctgatttaacaaaaatttaacgcgaattttaacaaaatattaacaaaatattaacgtttacaatttc
DU Number:
DU5506
Species:
Human
Synonyms:
TP53BP1
Sequence of Insert:
View Sequence

ggtaccGCCGCCACCATGTACCCATACGACGTACCAGACTATGCCGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGTTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAGCCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGG TTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGA AGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATAC TTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACT TCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAG AGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATT CCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAAT AGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAA ATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTT CCTTACCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTG CAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTC AAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGC TGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGT GAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACC ATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCA AGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATA GCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCCCAT ACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATA AATTATGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAA GAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAA TGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGT CTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGT GAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAG TTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCA GGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTT TCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCAAGG AGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTA CTAATAAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAAT AACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGT TTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTA CAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGG GGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCT CCATAGCCAGGGAGAAGAAGAGTTTGATATGCCTCAGCCTCCACATGGCC ATGTCTTACATCGTCACATGAGAACAATCCGGGAAGTACGCACACTTGTC ACTCGTGTCATTACAGATGTGTATTATGTGGATGGAACAGAAGTAGAAAG AAAAGTAACTGAGGAGACTGAAGAGCCAATTGTAGAGTGTCAGGAGTGTG AAACTGAAGTTTCCCCTTCACAGACTGGGGGCTCCTCAGGTGACCTGGGG GATATCAGCTCCTTCTCCTCCAAGGCATCCAGCTTACACCGCACATCAAG TGGGACAAGTCTCTCAGCTATGCACAGCAGTGGAAGCTCAGGGAAAGGAG CCGGACCACTCAGAGGGAAAACCAGCGGGACAGAACCCGCAGATTTTGCC TTACCCAGCTCCCGAGGAGGCCCAGGAAAACTGAGTCCTAGAAAAGGGGT CAGTCAGACAGGGACGCCAGTGTGTGAGGAGGATGGTGATGCAGGCCTTG GCATCAGACAGGGAGGGAAGGCTCCAGTCACGCCTCGTGGGCGTGGGCGA AGGGGCCGCCCACCTTCTCGGACCACTGGAACCAGAGAAACAGCTGTGCC TGGCCCCTTGGGCATAGAGGACATTTCACCTAACTTGTCACCAGATGATA AATCCTTCAGCCGTGTCGTGCCCCGAGTGCCAGACTCCACCAGACGAACA GATGTGGGTGCTGGTGCTTTGCGTCGTAGTGACTCTCCAGAAATTCCTTT CCAGGCTGCTGCTGGCCCTTCTGATGGCTTAGATGCCTCCTCTCCAGGAA ATAGCTTTGTAGGGCTCCGTGTTGTAGCCAAGTGGTCATCCAATGGCTAC TTTTACTCTGGGAAAATCACACGAGATGTCGGAGCTGGGAAGTATAAATT GCTCTTTGATGATGGGTACGAATGTGATGTGTTGGGCAAAGACATTCTGT TATGTGACCCCATCCCGCTGGACACTGAAGTGACGGCCCTCTCGGAGGAT GAGTATTTCAGTGCAGGAGTGGTGAAAGGACATAGGAAGGAGTCTGGGGA ACTGTACTACAGCATTGAAAAAGAAGGCCAAAGAAAGTGGTATAAGCGAA TGGCTGTCATCCTGTCCTTGGAGCAAGGAAACAGACTGAGAGAGCAGTAT GGGCTTGGCCCCTATGAAGCAGTAACACCTCTTACAAAGGCAGCAGATAT CAGCTTAGACAATTTGGTGGAAGGGAAGCGGAAACGGCGCAGTAACGTCA GCTCCCCAGCCACCCCTACTGCCTCCAGTAGCAGCAGCACAACCCCTACC CGAAAGATCACAGAAAGTCCTCGTGCCTCCATGGGAGTTCTCTCAGGCAA AAGAAAACTTATCACTTCTGAAGAGGAACGGTCCCCTGCCAAGCGAGGTC GCAAGTCTGCCACAGTAAAACCTGCCTTGCCCTTTAAGGTGGTGGTTATC TCAGCCATCCTGGCCCTGGTGGTGCTCACCATCATCTCCCTTATCATCCT CATCATGCTTTGGCAGAAGAAGCCACGTTACGAGATCCGATGGAAGGTGA TTGAGTCTGTGAGCTCTGACGGCCATGAGTACATCTACGTGGACCCCATG CAGCTGCCCTATGACTCCACGTGGGAGCTGCCGCGGGACCAGCTTGTGCT GGGACGCACCCTCGGCTCTGGGGCCTTTGGGCAGGTGGTGGAGGCCACGG CTCATGGCCTGAGCCATTCTCAGGCCACGATGAAAGTGGCCGTCAAGATG CTTAAATCCACAGCCCGCAGCAGTGAGAAGCAAGCCCTTATGTCGGAGCT GAAGATCATGAGTCACCTTGGGCCCCACCTGAACGTGGTCAACCTGTTGG GGGCCTGCACCAAAGGAGGACCCATCTATATCATCACTGAGTACTGCCGC TACGGAGACCTGGTGGACTACCTGCACCGCAACAAACACACCTTCCTGCA GCACCACTCCGACAAGCGCCGCCCGCCCAGCGCGGAGCTCTACAGCAATG CTCTGCCCGTTGGGCTCCCCCTGCCCAGCCATGTGTCCTTGACCGGGGAG AGCGACGGTGGCTACATGGACATGAGCAAGGACGAGTCGGTGGACTATGT GCCCATGCTGGACATGAAAGGAGACGTCAAATATGCAGACATCGAGTCCT CCAACTACATGGCCCCTTACGATAACTACGTTCCCTCTGCCCCTGAGAGG ACCTGCCGAGCAACTTTGATCAACGAGTCTCCAGTGCTAAGCTACATGGA CCTCGTGGGCTTCAGCTACCAGGTGGCCAATGGCATGGAGTTTCTGGCCT CCAAGAACTGCGTCCACAGAGACCTGGCGGCTAGGAACGTGCTCATCTGT GAAGGCAAGCTGGTCAAGATCTGTGACTTTGGCCTGGCTCGAGACATCAT GCGGGACTCGAATTACATCTCCAAAGGCAGCACCTTTTTGCCTTTAAAGT GGATGGCTCCGGAGAGCATCTTCAACAGCCTCTACACCACCCTGAGCGAC GTGTGGTCCTTCGGGATCCTGCTCTGGGAGATCTTCACCTTGGGTGGCAC CCCTTACCCAGAGCTGCCCATGAACGAGCAGTTCTACAATGCCATCAAAC GGGGTTACCGCATGGCCCAGCCTGCCCATGCCTCCGACGAGATCTATGAG ATCATGCAGAAGTGCTGGGAAGAGAAGTTTGAGATTCGGCCCCCCTTCTC CCAGCTGGTGCTGCTTCTCGAGAGACTGTTGGGCGAAGGTTACAAAAAGA AGTACCAGCAGGTGGATGAGGAGTTTCTGAGGAGTGACCACCCAGCCATC CTTCGGTCCCAGGCCCGCTTGCCTGGGTTCCATGGCCTCCGATCTCCCCT GGACACCAGCTCCGTCCTCTATACTGCCGTGCAGCCCAATGAGGGTGACA ACGACTATATCATCCCCCTGCCTGACCCCAAACCCGAGGTTGCTGACGAG GGCCCACTGGAGGGTTCCCCCAGCCTAGCCAGCTCCACCCTGAATGAAGT CAACACCTCCTCAACCATCTCCTGTGACAGCCCCCTGGAGCCCCAGGACG AACCAGAGCCAGAGCCCCAGCTTGAGCTCCAGGTGGAGCCGGAGCCAGAG CTGGAACAGTTGCCGGATTCGGGGTGCCCTGCGCCTCGGGCGGAAGCAGA GGATAGCTTCCTGTAGAACcctgcagg
Amino Acid Sequence:
View Sequence

MYPYDVPDYADPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFS MLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVAD PVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQ KEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQDVEENTVPYEVD KEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQ PSKDVHVVKEQNPPPARSEDMPFSPKASVAAMEAKEQLSAQELMESGLQI QKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHL LQLSGQRSLVQDSLSTNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKP MDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTP VFPPGSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSK TSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDGE NTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDT DTRDDISILATGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEALSSV LDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHL SLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLAILDQELEHK EQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIA PEIEPCAENRLDTKEEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRAD DPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHA SQSFCESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIG ISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCLRMKL VSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICE ARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGDHTIRQSQQPMK PISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSK ALIERPSQNNIGIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQNFGK QDATVQTERGSGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRHMR TIREVRTLVTRVITDVYYVDGTEVERKVTEETEEPIVECQECETEVSPSQ TGGSSGDLGDISSFSSKASSLHRTSSGTSLSAMHSSGSSGKGAGPLRGKT SGTEPADFALPSSRGGPGKLSPRKGVSQTGTPVCEEDGDAGLGIRQGGKA PVTPRGRGRRGRPPSRTTGTRETAVPGPLGIEDISPNLSPDDKSFSRVVP RVPDSTRRTDVGAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRV VAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLD TEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLE QGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSNVSSPATPTA SSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPAKRGRKSATVKP ALPFKVVVISAILALVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDG HEYIYVDPMQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQ ATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGP IYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNALPVGLPL PSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYD NYVPSAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRD LAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIF NSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQP AHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEE FLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDNDYIIPLP DPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQL ELQVEPEPELEQLPDSGCPAPRAEAEDSFL*
Antibiotic:
Amp
Comments:
N.B. Sequence differences in 53BP1 compared with NM_005657 CDS: c1590t (silent S530) a1647g (silent E549) Estimated MW of expressed protein : 248182 Daltons

Do you need any help? Please get in touch and we’ll be happy to lend a hand.