cDNA Clone - SNRK

Name: SNRK
Price per aliquot: £110.00
Expressed:
GST-HA-SNRK
Plasmid:
pEBG-2T-HA SNRK
Parent Plasmid:
pEBG2T
View Parent Plasmid

Snapgene File | Genbank File
agcgcccaatacgcaaaccgcctctccccgcgcgttggccgattcattaatgcagctggcacgacaggtttcccgactggaaagcgggcagtgagcgcaacgcaattaatgtgagttagctcactcattaggcaccccaggctttacactttatgcttccggctcgtatgttgtgtggaattgtgagcggataacaatttcacacaggaaacagctatgaccatgattacgccAAGCTTccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccatagtcccgcccctaactccgcccatcccgcccctaactccgcccagttccgcccattctccgccccatggctgactaattttttttatttatgcagaggccgaggccgcctcggcctctgagctattccagaagtagtgaggaggcttttttggaggcctaggcttttgcaaaaagctttgcaaagatggataaagttttaaacagagaggaatctttgcagctaatggaccttctaggtcttgaaaggagtgGGAATTggctccggtgcccgtcagtgggcagagcgcacatcgcccacagtccccgagaagttggggggaggggtcggcaattgaaccggtgcctagagaaggtggcgcggggtaaactgggaaagtgatgtcgtgtactggctccgcctttttcccgagggtgggggagaaccgtatataagtgcagtagtcgccgtgaacgttctttttcgcaacgggtttgccgccagaacacaggtaagtgccgtgtgtggttcccgcgggcctggcctctttacgggttatggcccttgcgtgccttgaattacttccacgcccctggctgcagtacgtgattcttgatcccgagcttcgggttggaagtgggtgggagagttcgaggccttgcgcttaaggagccccttcgcctcgtgcttgagttgaggcctggcctgggcgctggggccgccgcgtgcgaatctggtggcaccttcgcgcctgtctcgctgctttcgataagtctctagccatttaaaatttttgatgacctgctgcgacgctttttttctggcaagatagtcttgtaaatgcgggccaagatctgcacactggtatttcggtttttggggccgcgggcggcgacggggcccgtgcgtcccagcgcacatgttcggcgaggcggggcctgcgagcgcggccaccgagaatcggacgggggtagtctcaagctggccggcctgctctggtgcctggcctcgcgccgccgtgtatcgccccgccctgggcggcaaggctggcccggtcggcaccagttgcgtgagcggaaagatggccgcttcccggccctgctgcagggagctcaaaatggaggacgcggcgctcgggagagcgggcgggtgagtcacccacacaaaggaaaagggcctttccgtcctcagccgtcgcttcatgtgactccacggagtaccgggcgccgtccaggcacctcgattagttctcgagcttttggagtacgtcgtctttaggttggggggaggggttttatgcgatggagtttccccacactgagtgggtggagactgaagttaggccagcttggcacttgatgtaattctccttggaatttgccctttttgagtttggatcttggttcattctcaagcctcagacagtggttcaaagtttttttcttccatttcaggtgtcgtgagGAATTCtctagagatccctcgacctcgagatccattgtgctGGATCTacaatggcccctatactaggttattggaaaattaagggccttgtgcaacccactcgacttcttttggaatatcttgaagaaaaatatgaagagcatttgtatgagcgcgatgaaggtgataaatggcgaaacaaaaagtttgaattgggtttggagtttcccaatcttccttattatattgatggtgatgttaaattaacacagtctatggccatcatacgttatatagctgacaagcacaacatgttgggtggttgtccaaaagagcgtgcagagatttcaatgcttgaaggagcggttttggatattagatacggtgtttcgagaattgcatatagtaaagactttgaaactctcaaagttgattttcttagcaagctacctgaaatgctgaaaatgttcgaagatcgtttatgtcataaaacatatttaaatggtgatcatgtaacccatcctgacttcatgttgtatgacgctcttgatgttgttttatacatggacccaatgtgcctggatgcgttcccaaaattagtttgttttaaaaaacgtattgaagctatcccacaaattgataagtacttgaaatccagcaagtatatagcatggcctttgcagggctggcaagccacgtttggtggtggcgaccatcctccaaaatcggatctggttccgcgtGGATCCACTAGTGGTACCATCGATGCGGCCGCgactctagaGTGAGGgtccccacctgggacccttgagagtatcaggtctcccacgtgggagacaagaaatccctgtttaatatttaaacagcagtgttccccatctgggtccttgcacccctcactctggcctcagccgactgcacagcggcccctgcatccccttggctgtgaggcccctggacaagcagaggtggccagagctgggaggcatggccctggggtcccacgaatttgctggggaatctcgtttttcttcttaagacttttgggacatggtttgactcccgaacatcaccgacgcgtctcctgtttttctgggtggcctcgggacacctgccctgcccccacgagggtcaggactgtgactctttttagggccaggcaggtgcctggacatttgccttgctggacggggactggggatgtgggagggagcagacaggaggaatcatgtcaggcctgtgtgtgaaaggaagctccactgtcaccctccacctcttcaccccccactcaccagtgtcccctccactgtcacattgtaactgaacttcaggataataaagtgtttgcctccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaGAATTCactggccgtcgttttacaacgtcgtgactgggaaaaccctggcgttacccaacttaatcgccttgcagcacatccccctttcgccagctggcgtaatagcgaagaggcccgcaccgatcgcccttcccaacagttgcgcagcctgaatggcgaatggcgcctgatgcggtattttctccttacgcatctgtgcggtatttcacaccgcatacgtcaaagcaaccatagtacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcgggggctccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgatttgggtgatggttcacgtagtgggccatcgccctgatagacggtttttcgccctttgacgttggagtccacgttctttaatagtggactcttgttccaaactggaacaacactcaaccctatctcgggctattcttttgatttataagggattttgccgatttcggcctattggttaaaaaatgagctgatttaacaaaaatttaacgcgaattttaacaaaatattaacgtttacaattttatggtgcactctcagtacaatctgctctgatgccgcatagttaagccagccccgacacccgccaacacccgctgacgcgccctgacgggcttgtctgctcccggcatccgcttacagacaagctgtgaccgtctccgggagctgcatgtgtcagaggttttcaccgtcatcaccgaaacgcgcgagacgaaagggcctcgtgatacgcctatttttataggttaatgtcatgataataatggtttcttagacgtcaggtggcacttttcggggaaatgtgcgcggaacccctatttgtttatttttctaaatacattcaaatatgtatccgctcatgagacaataaccctgataaatgcttcaataatattgaaaaaggaagagtatgagtattcaacatttccgtgtcgcccttattcccttttttgcggcattttgccttcctgtttttgctcacccagaaacgctggtgaaagtaaaagatgctgaagatcagttgggtgcacgagtgggttacatcgaactggatctcaacagcggtaagatccttgagagttttcgccccgaagaacgttttccaatgatgagcacttttaaagttctgctatgtggcgcggtattatcccgtattgacgccgggcaagagcaactcggtcgccgcatacactattctcagaatgacttggttgagtactcaccagtcacagaaaagcatcttacggatggcatgacagtaagagaattatgcagtgctgccataaccatgagtgataacactgcggccaacttacttctgacaacgatcggaggaccgaaggagctaaccgcttttttgcacaacatgggggatcatgtaactcgccttgatcgttgggaaccggagctgaatgaagccataccaaacgacgagcgtgacaccacgatgcctgtagcaatggcaacaacgttgcgcaaactattaactggcgaactacttactctagcttcccggcaacaattaatagactggatggaggcggataaagttgcaggaccacttctgcgctcggcccttccggctggctggtttattgctgataaatctggagccggtgagcgtgggtctcgcggtatcattgcagcactggggccagatggtaagccctcccgtatcgtagttatctacacgacggggagtcaggcaactatggatgaacgaaatagacagatcgctgagataggtgcctcactgattaagcattggtaactgtcagaccaagtttactcatatatactttagattgatttaaaacttcatttttaatttaaaaggatctaggtgaagatcctttttgataatctcatgaccaaaatcccttaacgtgagttttcgttccactgagcgtcagaccccgtagaaaagatcaaaggatcttcttgagatcctttttttctgcgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagcggtggtttgtttgccggatcaagagctaccaactctttttccgaaggtaactggcttcagcagagcgcagataccaaatactgtccttctagtgtagccgtagttaggccaccacttcaagaactctgtagcaccgcctacatacctcgctctgctaatcctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccgggttggactcaagacgatagttaccggataaggcgcagcggtcgggctgaacggggggttcgtgcacacagcccagcttggagcgaacgacctacaccgaactgagatacctacagcgtgagctatgagaaagcgccacgcttcccgaagggagaaaggcggacaggtatccggtaagcggcagggtcggaacaggagagcgcacgagggagcttccagggggaaacgcctggtatctttatagtcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcaggggggcggagcctatggaaaaacgccagcaacgcggcctttttacggttcctggccttttgctggccttttgctcacatgttctttcctgcgttatcccctgattctgtggataaccgtattaccgcctttgagtgagctgataccgctcgccgcagccgaacgaccgagcgcagcgagtcagtgagcgaggaagc​
DU Number:
DU1294
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

gcggccgccaccATGTACCCATACGATGTGCCAGATTACGCCGCAGGATTTAAGCGAGGGTATGATGGAAAGATTGCTGGATTATATGATCTGGATAAAACCTTGGGTCGAGGCCATTTTGCCGTGGTTAAACTTGCCAGGCATGTCTTTACGGGTGAAAAGGTGGCAGTAAAAGTTATTGACAAGACAAAACTGGACACTCTAGCTACTGGTCATCTTTTCCAGGAAGTGAGATGCATGAAACTAGTGCAGCATCCTAACATCGTCCGCCTTTATGAAGTTATTGACACCCAGACCAAACTATATCTTATTCTAGAACTTGGGGATGAAGGAGATATGTTTGATTATATAATGAAACATGAGGAGGGTCTTAATGAAGACTTGCCCAAGAAGTATTTTGCTCAGATAGTTCATGCTATATCTTATTGCCATAAACTCCATGTGGTTCACAGAGACTTAAAACCAGAGAATGTAGTCTTCTTTGAAAAACAAGGTCTTGTAAAGTTGACAGACTTTGGGTTCAGCAACAAATTTCAACCAGGGAAGAAGCTCACTACAAGCTGTGGATCTCTTGCATATTCCGCTCCAGAAATTCTGCTTGGTGATGAGTATGATGCACCTGCAGTAGATATTTGGAGTCTGGGAGTGATCCTTTTCATGTTGGTGTGTGGGCAGCCGCCCTTTCAAGAAGCCAATGACAGTGAAACACTGACAATGATCATGGATTGCAAATATACAGTACCATCCCATGTGTCTAAAGAGTGTAAAGACCTAATCACACGGATGCTACAGAGAGATCCCAAGAGAAGGGCTTCTTTAGAAGAGATTGAAAATCATCCTTGGCTTCAGGGAGTGGACCCTTCACCAGCTACAAAGTATAACATTCCCCTTGTGTCATACAAAAATCTCTCGGAAGAGGAGCACAACAGCATCATTCAGCGCATGGTGCTTGGGGACATAGCGGATCGAGACGCCATTGTAGAAGCCCTGGAAACCAACAGGTATAACCATATCACAGCCACATACTTCCTGCTGGCTGAAAGGATCCTGAGAGAAAAGCAAGAGAAAGAAATACAGACCAGATCTGCAAGCCCGAGCAATATCAAGGCCCAGTTTAGGCAGTCATGGCCAACCAAAATTGATGTACCCCAGGACCTTGAGGATGACCTCACGGCCACTCCTTTGTCCCACGCGACTGTCCCTCAGTCTCCTGCTCGGGCTGCTGACAGTGTCCTCAATGGCCACAGGAGCAAAGGCCTGTGTGACTCAGCTAAGAAAGATGACCTCCCTGAGTTGGCTGGACCAGCACTCTCTACGGTGCCACCCGCAAGCTTAAAACCCACAGCCAGTGGGCGGAAGTGTCTGTTCAGGGTGGAAGAAGATGAAGAGGAAGATGAGGAGGACAAGAAACCCATGTCCCTCTCAACACAAGTGGTTTTGCGCCGGAAGCCATCTGTAACCAACCGCCTGACATCCAGGAAGAGTGCGCCCGTCCTCAACCAGATCTTTGAGGAAGGGGAATCTGATGATGAGTTTGACATGGATGAGAATCTGCCTCCCAAGTTGAGCAGGTTAAAGATGAATATAGCTTCTCCAGGTACAGTTCACAAACGCTACCACCGGAGGAAAAGTCAGGGCCGGGGCTCCAGCTGCAGTAGTTCGGAGACCAGTGATGATGATTCTGAAAGCCGGCGGCGGCTCGATAAAGATAGCGGGTTCACCTACTCCTGGCACCGACGGGATAGCAGCGAGGGGCCCCCTGGCAGTGAGGGGGATGGCGGGGGCCAGAGCAAGCCGAGCAATGCCAGTGGAGGGGTGGACAAGGCCAGCCCCAGTGAGAACAATGCTGGTGGGGGCAGTCCCTCCAGCGGCTCGGGTGGCAACCCCACCAATACATCGGGTACCACACGCCGCTGTGCCGGCCCCAGCAACTCCATGCAGCTGGCCTCTCGCAGTGCTGGGGAGCTCGTTGAGAGCCTCAAACTCATGAGCCTCTGCCTCGGCTCCCAGCTTCATGGGAGCACCAAGTACATTATTGATCCACAGAATGGCTTGTCATTTTCCAGTGTGAAAGTCCAAGAGAAATCTACGTGGAAAATGTGCATTAGCTCCACAGGGAATGCAGGGCAGGTCCCTGCAGTGGGCGGCATAAAGTTTTTCTCTGACCACATGGCAGATACCACCACTGAATTGGAACGGATAAAGAGCAAGAACCTGAAAAATAACGTGCTGCAGCTACCTCTGTGCGAAAAGACCATCTCTGTGAACATCCAGCGGAACCCTAAGGAGGGGCTGCTGTGCGCATCCAGCCCAGCCAGCTGTTGCCATGTCATCTGAgcggccgc
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLVPRGSTSGTIDAAATMYPYDVPDYAAGFKRGYDGKIAGLYDLDKTLGRGHFAVVKLARHVFTGEKVAVKVIDKTKLDTLATGHLFQEVRCMKLVQHPNIVRLYEVIDTQTKLYLILELGDEGDMFDYIMKHEEGLNEDLPKKYFAQIVHAISYCHKLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNKFQPGKKLTTSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILFMLVCGQPPFQEANDSETLTMIMDCKYTVPSHVSKECKDLITRMLQRDPKRRASLEEIENHPWLQGVDPSPATKYNIPLVSYKNLSEEEHNSIIQRMVLGDIADRDAIVEALETNRYNHITATYFLLAERILREKQEKEIQTRSASPSNIKAQFRQSWPTKIDVPQDLEDDLTATPLSHATVPQSPARAADSVLNGHRSKGLCDSAKKDDLPELAGPALSTVPPASLKPTASGRKCLFRVEEDEEEDEEDKKPMSLSTQVVLRRKPSVTNRLTSRKSAPVLNQIFEEGESDDEFDMDENLPPKLSRLKMNIASPGTVHKRYHRRKSQGRGSSCSSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSNASGGVDKASPSENNAGGGSPSSGSGGNPTNTSGTTRRCAGPSNSMQLASRSAGELVESLKLMSLCLGSQLHGSTKYIIDPQNGLSFSSVKVQEKSTWKMCISSTGNAGQVPAVGGIKFFSDHMADTTTELERIKSKNLKNNVLQLPLCEKTISVNIQRNPKEGLLCASSPASCCHVI*
Antibiotic:
Amp
Comments:
Mammalian expression plasmid to express SNRK with N terminal GST and HA tags. Changes to NM_017719 CDS sequence: a290g (E97G)* c346g (P116A)* t1488c (silent in D496)* g1758a (silent in P586) * changes also present in SNRK sequence in Sugen database

Do you need any help? Please get in touch and we’ll be happy to lend a hand.