cDNA Clone - AATYK NCBI AY236858

Name: AATYK NCBI AY236858
Price per aliquot: £110.00
Expressed:
FLAG-AATYK 1-418 Ddead
Plasmid:
pCMV-FLAG AATYK 1-418 Ddead
Parent Plasmid:
pCMV5 FLAG1
View Parent Plasmid

Snapgene File | Genbank File
cccattcgccattcaggctgcgcaactgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggggatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacgacggccagtgccaagctgatctatacattgaatcaatattggcaattagccatattagtcattggttatatagcataaatcaatattggctattggccattgcatacgttgtatctatatcataatatgtacatttatattggctcatgtccaatatgaccgccatgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacaccaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccgtcaGAATTGGCCACCATGgactacaaggacgatgacgataagGGATCCCCGGAATTCCCGGGTCGACTCGAGCGGCCGCGGATCTcgggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaacctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggctcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgttgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggggtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccaccttggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctgattttaaaataactataccagcaggaggacgtccagacacagcataggctacctgccatggcccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtccactcagtagatgcctgttgaattgggtacgcggccagcttctgtggaatgtgtgtcagttagggtgtggaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccaggtgtggaaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccatagtcccgcccctaactccgcccatcccgcccctaactccgcccagttccgcccattctccgccccatggctgactaattttttttatttatgcagaggccgaggccgcctcggcctctgagctattccagaagtagtgaggaggcttttttggaggcctaggcttttgcaaaaagctcctcgaggaactgaaaaaccagaaagttaattccctatagtgagtcgtattaaattcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaaggacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcggggcatccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtagtgggccatcgccctgatagacggtttttcgccctttgacgttggagtccacgttctttaatagtggactcttgttccaaactggaacaacactcaaccctatctcggtctattcttttgatttataagggattttgccgatttcggcctattggttaaaaaatgagctgatttaacaaaaatttaacgcgaattttaacaaaatattaacaaaatattaacgtttacaatttc
DU Number:
DU10592
Genbank:
Synonyms:
AATK
Sequence of Insert:
View Sequence

AGATCTATGTCGTCGTCCTTCTTCAACCCCAGCTTTGCCTTCAGCTCCCACTTCGACCCGGACGGTGCCCCGCTCAGTGAGCTGTCCTGGTCCTCGTCCCTCGCGGTGGTAGCCGTGTCCTTCTCTGGAATCTTCACTGTCGTCATCCTCATGCTGGCCTGCCTGTGTTGTAAGAAGGGCGGCATCGGGTTCAAGGAGTTTGAGAATGCTGAAGGGGATGAGTATGTGGCCGACTTCTCGGAGCAGGGCTCCCCGGCTGCAGCTGCACAGACCGGCCCCGATGTGTATGTCCTGCCCCTCACCGAGGTCTCCTTACCCATGGCCAAGCAGCCGGGTCGCTCCGTGCAACTTCTCAAGTCCACGGACCTGGGCCGGCACAGCCTCCTGTACTTAAAGGAGATTGGCCACGGCTGGTTTGGGAAGGTGTTTTTGGGGGAGGTACACTCGGGCGTCAGTGGCACGCAGGTGGTGGTGAAGGAGCTGAAGGTGAGCGCCAGCGTGCAGGAGCAGATGCAGTTCCTGGAGGAGGCGCAGCCCTACAGGGCCCTGCAGCACAGCAACCTGCTCCAGTGCCTGGCCCAGTGTGCTGAAGTGACCCCCTACCTGCTGGTTATGGAGTTCTGTCCACTGGGGGACCTCAAAGGTTATCTACGGAGCTGCCGGGTGACAGAGTCCATGGCGCCTGACCCACTTACCTTGCAGCGCATGGCGTGCGAGGTGGCGTGTGGCGTCTTGCATCTACATCGACACAACTATGTACACAGTGACCTGGCCCTGAGGAACTGCCTGCTTACGGCTGACCTGACAGTGAAGGTTGGTGATTATGGCCTGTCGCATTGCAAATACAGGGAAGACTATCTCGTGACCGCTGACCAGCTGTGGGTGCCGCTGCGCTGGATCGCGCCAGAGCTGGTGGACGAGGTTCACGGCAACCTGCTGGTGGTGGACCAGACCAAGAGCAGCAACGTGTGGTCCCTGGGTGTGACCATCTGGGAGCTTTTCGAGTTGGGTGCGCAGCCGTACCCCCAGCACTCGGACCGGCAGGTGCTGGCTTACGCCGTCCGGGAGCAGCAGCTTAAGTTGCCCAAGCCCCAGCTGCAGCTGGCTCTATCTGATCGATGGTACGAGGTGATGCAGTTCTGCTGGCTGCAGCCAGAGCAGAGGCCCACAGCTGAAGAGGTTCATCTACTGCTGTCCTACTTGTGTGCTAAGGGCACCACAGAATTGGAGGAGGAGTTTGAGCGGCGCTGGCGCTCCCTGCGGCCCGGGGGCAGCACGGGCCTGGGCTCGGGTTCTGCAGCCCCAGCAGCTGCCACCGCCGCCTCCGCGGAGCTCACCGCTGCCTCGTCTTTCCCGCTGCTGGAGCGGTTCACCAGCGACGGCTTTCACGTGGACAGTGATGACGTGCTGACGGTCACGGAGACAAGCCACGGCCTCAACTTTGAATACAAGTGGGAGGCTGGCTGTGGCGCTGAGGAGTACCCACCCTCGGGGGCTGCATCAAGCCCAGGCTCGGCAGCGCGCCTGCAGGAGTTGTGCGCGCCTGACAGTTCACCGCCGGGTGTGGTGCCAGTCCTCAGTGCCCACAGCCCCTCAGTGGGTAGCGAGTACTTCATCCGCCTGGAGGGGGCAGTGCCTGCTGCTGGCCACGATCCAGACTGTGCCGGCTGCGCTCCCAGCCCCCAGGCTGTGACTGACCAGGACAATAACTCTGAGGAGAGCACTGTTGCGTCCCTTGCCATGGAGCCATTGCTGGGCCATGCACCCCCAACTGAGGGTCTGTGGGGCCCCTGTGACCACCATTCACATAGGAGGCAAGGGTCACCCTGTCCCTCACGCTCACCCTCTCCTGGGACCCCGATGTTGCCAGCTGAAGACATAGACTGGGGTGTGGCTACCTTCTGCCCGCCCTTCTTTGATGACCCACTGGGTGCATCTCCCTCGGGGAGTCCTGGGGCCCAGCCCTCCCCCAGTGATGAGGAGCCAGAGGAGGGGAAGGTGGGGTTGGCCGCTCAGTGTGGACACTGGAGCTCTAACATGTCAGCTAACAACAACAGTGCCAGTCGCGACCCAGAATCCTGGGATCCTGGCTATGTTAGCAGCTTCACAGACAGCTACAGGGACGACTGCTCCAGCTTAGAGCAGACCCCTCGAGCCTCCCCTGAGGTGGGCCATCTCCTGTCCCAGGAGGATCCCAGAGATTTTCTCCCTGGGCTAGTAGCAGTCTCCCCTGGTCAGGAGCCAAGCCGTCCCTTCAACCTGCTCCCCCTGTGTCCTGCCAAAGGCCTGGCACCTGCTGCCTGCCTCATCACATCCCCTTGGACAGAGGGAGCTGTGGGTGGGGCTGAGAACCCCATTGTGGAACCCAAACTTGCCCAGGAGGCTGAGGGATCTGCTGAACCCCAGCTACCCCTTCCTTCCGTCCCCTCCCCATCCTGTGAAGGAGCCTCACTTCCCTCGGAGGAGGCAAGCGCTCCTGACATCCTACCTGCCTCACCCACACCCGCTGCTGGCAGCTGGGTGACCGTCCCTGAGCCAGCCCCCACCCTGGAGAGCAGCGGCAGTTCTCTGGGGCAAGAGGCACCCAGCAGCGAGGACGAAGACACGACCGAGGCAACATCAGGAGTCTTCACCGACCTGTCCAGTGACGGCCCACACACGGAGAAGTCAGGCATAGTACCAGCCTTGCGCAGTCTGCAGAAGCAGGTGGGGACCCCTGACTCCCTGGACTCTCTGGACATACCGTCCTCAGCCAGTGATGGTGGCTGTGAGGTCTTAAGCCCATCAGCTGCTGGTCCACCTGGCGGGCAGCCCCGTGCTGTGGACAGTGGCTATGATACAGAGAACTATGAGTCTCCTGAGTTTGTGCTCAAGGAGGCCCATGAGTCGAGTGAGCCTGAGGCCTTTGGGGAGCCAGCCTCAGAGGGTGAAAGCCCAGGGCCCGATCCTCTGCTCTCTGTCTCCCTTGGTGGCCTCAGCAAGAAGAGCCCCTACCGAGACTCTGCCTACTTTTCAGACCTGGATGCCGAGTCCGAACCCACCTTTGGCCCTGAGAAGCACAGTGGGATCCAGGACTCCCAAAAGGAGCAAGACCTGAGGAGCCCACCTAGCCCAGGGCATCAGTCTGTGCAGGCTTTTCCCAGGTCTGCAGTGTCCAGCGAGGTGCTGTCCCCTCCACAGCAGTCAGAGGAGCCCTTGCCAGAAGTCCCCAGGCCAGAGCCTCTCGGGGCTCAAGGCCCAGTTGGAGTGCAGCCTGTGCCCGGCCCAAGTCATTCCAAATGTTTCCCGCTGACCTCCGTTCCACTGATCTCAGAAGGCAGTGGCACGGAGCCCCAGGGTCCCTCAGGACAGCTGTCAGGGCGAGCCCAGCAGGGGCAGATGGGCAATCCTAGCACACCCAGATCCCCGCTCTGCCTGGCCCTGCCTGGCCACCCCGGGGCTTTGGAGGGCCGGCCGGAGGAGGATGAGGACACCGAGGACAGCGAGGAGTCTGATGAGGAGCTCCGGTGCTACAGCGTCCAGGAGCCCAGTGAGGACAGCGAGGAGGAGCCGCCAGCGGTGCCCGTGGTGGTGGCTGAGAGCCAGAGTGCCCGAAATCTACGCAGCCTGCTGAAGATGCCCAGCCTGCTGTCAGAGGCCTTCTGTGACGACCTGGAGCGCAAGAAGAAGGCTGTGTCCTTCTTCGATGATGTCACGGTCTACCTCTTTGACCAGGAAAGCCCCACCCGAGAGACTGGGGAGCCCTTTCCCAGCACAAAGGAATCACTCCCTACGTTCCTGGAGGGTGGCCCCAGCTCACCCAGTGCCACCGGCCTGCCACTGCGGGCTGGCCACTCTCCTGACAGCTCTGCTCCTGAACCAGGCAGTAGGTTCGAATGGGATGGTGATTTCCCGTTGGTGCCCGGCAAGGCTGCTTTGGTGACTGAGCTGGATCCTGCTGACCCTGTCCTGGCGGCGCCTCCCACGCCAGCTGCGCCCTTCTCACGCTTCACCGTGTCACCCACACCTGCCTCCCGCTTTTCCATCACCCACATATCTGACTCAGATGCCCAGTCCGTGGGAGGCCCAGCAGCAGGTGCTGGGGGCCGATACACAGAGGCTTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MDYKDDDDKGSMSSSFFNPSFAFSSHFDPDGAPLSELSWSSSLAVVAVSFSGIFTVVILMLACLCCKKGGIGFKEFENAEGDEYVADFSEQGSPAAAAQTGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDLGRHSLLYLKEIGHGWFGKVFLGEVHSGVSGTQVVVKELKVSASVQEQMQFLEEAQPYRALQHSNLLQCLAQCAEVTPYLLVMEFCPLGDLKGYLRSCRVTESMAPDPLTLQRMACEVACGVLHLHRHNYVHSVLALRNCLLTADLTVKVGAYGLSHCKYREDYLVTADQLWVPLRWIAPELVDEVHGNLLVVDQTKSSNVWSLGVTIWELFELGAQPYPQHSDRQVLAYAVREQQLKLPKPQLQLALSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGTTELEEEFERRWRSL*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.