cDNA Clone - A20

Name: A20
Price per aliquot: £110.00
Expressed:
HA A20 C624A C627A
Plasmid:
pCMV-HA-2 A20 C624A C627A
Parent Plasmid:
pCMV5 HA2
View Parent Plasmid

Snapgene File | Genbank File
cccattcgccattcaggctgcgcaactgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggggatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacgacggccagtgccaagctgatctatacattgaatcaatattggcaattagccatattagtcattggttatatagcataaatcaatattggctattggccattgcatacgttgtatctatatcataatatgtacatttatattggctcatgtccaatatgaccgccatgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacaccaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccgtcagaATTGGCCACCATGTACCCATACGATGTGCCAGATTACGCCgGGATCCCCGGAATTCCCGGGTCGACTCGAGCGGCCGCGATCCCGGGtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaacctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggctcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgttgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggggtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccaccttggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctgattttaaaataactataccagcaggaggacgtccagacacagcataggctacctgccatggcccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtccactcagtagatgcctgttgaattgggtacgcggccagcttctgtggaatgtgtgtcagttagggtgtggaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccaggtgtggaaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccatagtcccgcccctaactccgcccatcccgcccctaactccgcccagttccgcccattctccgccccatggctgactaattttttttatttatgcagaggccgaggccgcctcggcctctgagctattccagaagtagtgaggaggcttttttggaggcctaggcttttgcaaaaagctcctcgaggaactgaaaaaccagaaagttaattccctatagtgagtcgtattaaattcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaaggacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcggggcatccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtagtgggccatcgccctgatagacggtttttcgccctttgacgttggagtccacgttctttaatagtggactcttgttccaaactggaacaacactcaaccctatctcggtctattcttttgatttataagggattttgccgatttcggcctattggttaaaaaatgagctgatttaacaaaaatttaacgcgaattttaacaaaatattaacaaaatattaacgtttacaatttc
DU Number:
DU32911
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GCGGCCGCGATGGCTGAACAAGTCCTTCCTCAGGCTTTGTATTTGAGCAA TATGCGGAAAGCTGTGAAGATACGGGAGAGAACTCCAGAAGACATTTTTA AACCTACTAATGGGATCATTCATCATTTTAAAACCATGCACCGATACACA CTGGAAATGTTCAGAACTTGCCAGTTTTGTCCTCAGTTTCGGGAGATCAT CCACAAAGCCCTCATCGACAGAAACATCCAGGCCACCCTGGAAAGCCAGA AGAAACTCAACTGGTGTCGAGAAGTCCGGAAGCTTGTGGCGCTGAAAACG AACGGTGACGGCAATTGCCTCATGCATGCCACTTCTCAGTACATGTGGGG CGTTCAGGACACAGACTTGGTACTGAGGAAGGCGCTGTTCAGCACGCTCA AGGAAACAGACACACGCAACTTTAAATTCCGCTGGCAACTGGAGTCTCTC AAATCTCAGGAATTTGTTGAAACGGGGCTTTGCTATGATACTCGGAACTG GAATGATGAATGGGACAATCTTATCAAAATGGCTTCCACAGACACACCCA TGGCCCGAAGTGGACTTCAGTACAACTCACTGGAAGAAATACACATATTT GTCCTTTGCAACATCCTCAGAAGGCCAATCATTGTCATTTCAGACAAAAT GCTAAGAAGTTTGGAATCAGGTTCCAATTTCGCCCCTTTGAAAGTGGGTG GAATTTACTTGCCTCTCCACTGGCCTGCCCAGGAATGCTACAGATACCCC ATTGTTCTCGGCTATGACAGCCATCATTTTGTACCCTTGGTGACCCTGAA GGACAGTGGGCCTGAAATCCGAGCTGTTCCACTTGTTAACAGAGACCGGG GAAGATTTGAAGACTTAAAAGTTCACTTTTTGACAGATCCTGAAAATGAG ATGAAGGAGAAGCTCTTAAAAGAGTACTTAATGGTGATAGAAATCCCCGT CCAAGGCTGGGACCATGGCACAACTCATCTCATCAATGCCGCAAAGTTGG ATGAAGCTAACTTACCAAAAGAAATCAATCTGGTAGATGATTACTTTGAA CTTGTTCAGCATGAGTACAAGAAATGGCAGGAAAACAGCGAGCAGGGGAG GAGAGAGGGGCACGCCCAGAATCCCATGGAACCTTCCGTGCCCCAGCTTT CTCTCATGGATGTAAAATGTGAAACGCCCAACTGCCCCTTCTTCATGTCT GTGAACACCCAGCCTTTATGCCATGAGTGCTCAGAGAGGCGGCAAAAGAA TCAAAACAAACTCCCAAAGCTGAACTCCAAGCCGGGCCCTGAGGGGCTCC CTGGCATGGCGCTCGGGGCCTCTCGGGGAGAAGCCTATGAGCCCTTGGCG TGGAACCCTGAGGAGTCCACTGGGGGGCCTCATTCGGCCCCACCGACAGC ACCCAGCCCTTTTCTGTTCAGTGAGACCACTGCCATGAAGTGCAGGAGCC CCGGCTGCCCCTTCACACTGAATGTGCAGCACAACGGATTTTGTGAACGT TGCCACAACGCCCGGCAACTTCACGCCAGCCACGCCCCAGACCACACAAG GCACTTGGATCCCGGGAAGTGCCAAGCCTGCCTCCAGGATGTTACCAGGA CATTTAATGGGATCTGCAGTACTTGCTTCAAAAGGACTACAGCAGAGGCC TCCTCCAGCCTCAGCACCAGCCTCCCTCCTTCCTGTCACCAGCGTTCCAA GTCAGATCCCTCGCGGCTCGTCCGGAGCCCCTCCCCGCATTCTTGCCACA GAGCTGGAAACGACGCCCCTGCTGGCTGCCTGTCTCAAGCTGCACGGACT CCTGGGGACAGGACGGGGACGAGCAAGTGCAGAAAAGCCGGCTGCGTGTA TTTTGGGACTCCAGAAAACAAGGGCTTTGCCACACTGGCTTTCATCGAGT ACAGAGAAAACAAACATTTTGCTGCTGCCTCAGGGAAAGTCAGTCCCACA GCGTCCAGGTTCCAGAACACCATTCCGTGCCTGGGGAGGGAATGCGGCAC CCTTGGAAGCACCATGTTTGAAGGATACTGCCAGAAGTGTTTCATTGAAG CTCAGAATCAGAGATTTCATGAGGCCAAAAGGACAGAAGAGCAACTGAGA TCGAGCCAGCGCAGAGATGTGCCTCGAACCACACAAAGCACCTCAAGGCC CAAGTGCGCCCGGGCCTCCTGCAAGAACATCCTGGCCTGCCGCAGCGAGG AGCTCTGCATGGAGTGTCAGCATCCCAACCAGAGGATGGGCCCTGGGGCC CACCGGGGTGAGCCTGCCCCCGAAGACCCCCCCAAGCAGCGTTGCCGGGC CCCCGCCTGTGATCATTTTGGCAATGCCAAGTGCAACGGCTACTGCAACG AATGCTTTCAGTTCAAGCAGATGTATGGCTAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGIPGIPGSTRAAAMAEQVLPQALYLSNMRKAVKIRERTPE DIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATL ESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALF STLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMAST DTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPL KVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVN RDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINA AKLDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRREGHAQNPMEPSV PQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPKLNSKPGP EGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMK CRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQD VTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPH SCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFATLA FIEYRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKC FIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILAC RSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNG YCNECFQFKQMYG*
Antibiotic:
Amp
Comments:
N ter HA for mammalian expression Estimated MW of expressed protein : 91911 Daltons

Do you need any help? Please get in touch and we’ll be happy to lend a hand.