cDNA Clone - A20 (mouse)

Name: A20 (mouse)
Price per aliquot: £110.00
Expressed:
HA A20 C103A
Plasmid:
pCMV-HA-1 A20 (mouse) C103A
Parent Plasmid:
pCMV5 HA1
View Parent Plasmid

Snapgene File | Genbank File
cccattcgccattcaggctgcgcaactgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggggatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacgacggccagtgccaagctgatctatacattgaatcaatattggcaattagccatattagtcattggttatatagcataaatcaatattggctattggccattgcatacgttgtatctatatcataatatgtacatttatattggctcatgtccaatatgaccgccatgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacaccaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccgtcagaaATTGGCCACCATGTACCCATACGATGTGCCAGATTACGCCGGATCCCCGGAATTCCCGGGTCGACTCGAGCGGCCGCGATCCCGGGtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaacctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggctcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgttgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggggtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccaccttggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctgattttaaaataactataccagcaggaggacgtccagacacagcataggctacctgccatggcccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtccactcagtagatgcctgttgaattgggtacgcggccagcttctgtggaatgtgtgtcagttagggtgtggaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccaggtgtggaaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccatagtcccgcccctaactccgcccatcccgcccctaactccgcccagttccgcccattctccgccccatggctgactaattttttttatttatgcagaggccgaggccgcctcggcctctgagctattccagaagtagtgaggaggcttttttggaggcctaggcttttgcaaaaagctcctcgaggaactgaaaaaccagaaagttaattccctatagtgagtcgtattaaattcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaaggacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcggggcatccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtagtgggccatcgccctgatagacggtttttcgccctttgacgttggagtccacgttctttaatagtggactcttgttccaaactggaacaacactcaaccctatctcggtctattcttttgatttataagggattttgccgatttcggcctattggttaaaaaatgagctgatttaacaaaaatttaacgcgaattttaacaaaatattaacaaaatattaacgtttacaatttc
DU Number:
DU32899
Genbank:
Species:
Mouse
Sequence of Insert:
View Sequence

GGATCCATGGCTGAACAACTTCTTCCTCAGGCTTTGTATTTGAGCAATAT GCGGAAAGCTGTGAAGATACGAGAGAGAACCCCAGAAGACATTTTCAAAC CTACCAATGGGATCATCTATCACTTTAAAACCATGCACCGATACACGCTG GAGATGTTCAGAACATGCCAGTTTTGCCCACAGTTCCGAGAGATCATCCA CAAAGCACTTATTGACAGAAGTGTCCAGGCTTCCCTGGAAAGCCAGAAGA AGCTCAACTGGTGTCGTGAAGTCAGGAAGCTCGTGGCTCTGAAAACCAAT GGTGATGGAAACGCCCTCATGCATGCAGCTTGTCAGTACATGTGGGGTGT TCAGGATACTGACCTGGTCCTGAGGAAGGCCCTCTGCAGCACCCTTAAGG AGACAGACACTCGGAACTTTAAATTCCGCTGGCAGCTGGAATCTCTGAAA TCTCAGGAATTTGTGGAAACAGGACTTTGCTACGACACTCGGAACTGGAA TGACGAATGGGACAACTTGGTCAAAATGGCATCAGCAGACACACCTGCAG CCCGAAGTGGACTTCAGTACAATTCCCTGGAAGAAATCCACATATTTGTC CTCAGCAACATCCTCAGAAGACCCATCATTGTCATTTCAGACAAAATGCT AAGAAGTTTGGAATCTGGTTCCAATTTTGCTCCTTTGAAAGTGGGTGGGA TTTATCTGCCTCTTCACTGGCCTGCCCAGGAGTGTTACAGATATCCCATC GTCCTAGGCTATGACAGCCAGCACTTTGTACCCCTGGTGACCCTGAAGGA CAGTGGACCTGAACTTCGCGCTGTTCCACTTGTTAACAGAGACCGGGGTA GGTTTGAAGACTTAAAAGTTCACTTCTTGACAGATCCTGAGAATGAGATG AAGGAAAAGCTTCTAAAGGAGTACTTGATAGTGATGGAGATCCCTGTGCA AGGCTGGGACCACGGCACGACTCACCTGATCAACGCTGCAAAATTGGATG AAGCTAACTTACCCAAAGAAATAAATTTGGTAGACGATTACTTTGAGCTT GTTCAGCACGAATACAAGAAATGGCAGGAGAACAGCGATCAGGCCAGGAG AGCGGCACATGCGCAGAACCCCTTGGAGCCTTCCACACCCCAGCTATCAC TCATGGATATAAAATGTGAGACACCCAACTGTCCTTTCTTCATGTCCGTG AACACTCAGCCTTTATTCCACGAATGCTCAGAGAGGCGCCAAAAGAATCA GAGCAAGCTCCCAAAGCTGAACTCGAAGCTAGGCCCTGAAGGACTCCCAG GCGTGGGACTTGGCTCCTCAAACTGGAGCCCCGAGGAAACCGCTGGAGGA CCTCATTCAGCCCCACCCACAGCACCCAGCCTTTTTCTCTTCAGTGAGAC CACTGCAATGAAGTGCAGGAGTCCTGGGTGCCCTTTTACTTTGAATGTGC AGCATAATGGATTCTGTGAGCGTTGCCACGCCCGGCAGATTAATGCCAGC CACACCGCAGACCCTGGAAAGTGCCAAGCCTGCCTTCAGGATGTCACTCG GACCTTTAATGGCATCTGCAGTACCTGTTTCAAAAGGACTACAGCAGAGC CCAGCTCCAGCCTCACTTCCAGTATCCCTGCCTCCTGTCACCAACGCTCC AAGTCTGACCCCTCACAACTCATCCAAAGTCTCACTCCACACTCTTGCCA CCGGACTGGAAATGTCTCTCCTTCTGGCTGCCTCTCCCAGGCTGCACGGA CTCCAGGAGACAGAGCAGGGACAAGCAAGTGCAGGAAAGCTGGCTGCATG TATTTTGGGACTCCAGAAAACAAGGGCTTTTGCACTCTATGTTTCATCGA ATACAGAGAAAATAAGCAGTCTGTTACTGCCTCTGAGAAAGCTGGTTCCC CGGCCCCCAGGTTCCAGAACAATGTCCCGTGCCTGGGCAGGGAGTGCGGC ACACTCGGAAGCACCATGTTTGAAGGGTACTGTCAGAAGTGTTTCATCGA AGCTCAGAACCAGAGATTCCATGAAGCAAGAAGAACGGAAGAACAGCTGA GATCAAGCCAGCATAGAGACATGCCTCGAACTACACAGGTAGCCTCAAGG CTGAAATGTGCCCGGGCCTCCTGCAAGAACATTCTGGCCTGTCGCAGTGA GGAACTCTGTATGGAGTGCCAGCACCTAAGCCAACGAGTAGGTTCTGTGG CCCACCGGGGTGAGCCCACGCCTGAAGAGCCCCCTAAACAGCGCTGCCGG GCCCCTGCTTGTGATCACTTTGGCAATGCCAAGTGTAATGGTTACTGCAA TGAGTGCTACCAGTTCAAGCAGATGTATGGCTAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGSMAEQLLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIY HFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRSVQASLESQKKLNWCRE VRKLVALKTNGDGNALMHAACQYMWGVQDTDLVLRKALCSTLKETDTRNF KFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLVKMASADTPAARSGLQY NSLEEIHIFVLSNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHW PAQECYRYPIVLGYDSQHFVPLVTLKDSGPELRAVPLVNRDRGRFEDLKV HFLTDPENEMKEKLLKEYLIVMEIPVQGWDHGTTHLINAAKLDEANLPKE INLVDDYFELVQHEYKKWQENSDQARRAAHAQNPLEPSTPQLSLMDIKCE TPNCPFFMSVNTQPLFHECSERRQKNQSKLPKLNSKLGPEGLPGVGLGSS NWSPEETAGGPHSAPPTAPSLFLFSETTAMKCRSPGCPFTLNVQHNGFCE RCHARQINASHTADPGKCQACLQDVTRTFNGICSTCFKRTTAEPSSSLTS SIPASCHQRSKSDPSQLIQSLTPHSCHRTGNVSPSGCLSQAARTPGDRAG TSKCRKAGCMYFGTPENKGFCTLCFIEYRENKQSVTASEKAGSPAPRFQN NVPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEARRTEEQLRSSQHRD MPRTTQVASRLKCARASCKNILACRSEELCMECQHLSQRVGSVAHRGEPT PEEPPKQRCRAPACDHFGNAKCNGYCNECYQFKQMYG*
Antibiotic:
Amp
Comments:
N terminal HA for mammalian expression Estimated MW of expressed protein : 89022 Daltons

Do you need any help? Please get in touch and we’ll be happy to lend a hand.