cDNA Clone - A20

Name: A20
Price per aliquot: £110.00
Expressed:
FLAG A20 1-467
Plasmid:
pCMV-FLAG-2 A20 1-467
Parent Plasmid:
pCMV5 FLAG2
View Parent Plasmid

Snapgene File | Genbank File
cccattcgccattcaggctgcgcaactgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggggatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacgacggccagtgccaagctgatctatacattgaatcaatattggcaattagccatattagtcattggttatatagcataaatcaatattggctattggccattgcatacgttgtatctatatcataatatgtacatttatattggctcatgtccaatatgaccgccatgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacaccaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccgtcaGAATTGGCCACCATGgactacaaggacgatgacgataaggGGATCCCCGGAATTCCCGGGTCGACTCGAGCGGCCGCGGATCTcgggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaacctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggctcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgttgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggggtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccaccttggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctgattttaaaataactataccagcaggaggacgtccagacacagcataggctacctgccatggcccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtccactcagtagatgcctgttgaattgggtacgcggccagcttctgtggaatgtgtgtcagttagggtgtggaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccaggtgtggaaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccatagtcccgcccctaactccgcccatcccgcccctaactccgcccagttccgcccattctccgccccatggctgactaattttttttatttatgcagaggccgaggccgcctcggcctctgagctattccagaagtagtgaggaggcttttttggaggcctaggcttttgcaaaaagctcctcgaggaactgaaaaaccagaaagttaattccctatagtgagtcgtattaaattcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaaggacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcggggcatccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtagtgggccatcgccctgatagacggtttttcgccctttgacgttggagtccacgttctttaatagtggactcttgttccaaactggaacaacactcaaccctatctcggtctattcttttgatttataagggattttgccgatttcggcctattggttaaaaaatgagctgatttaacaaaaatttaacgcgaattttaacaaaatattaacaaaatattaacgtttacaatttc
DU Number:
DU32898
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GCGGCCGCGATGGCTGAACAAGTCCTTCCTCAGGCTTTGTATTTGAGCAA TATGCGGAAAGCTGTGAAGATACGGGAGAGAACTCCAGAAGACATTTTTA AACCTACTAATGGGATCATTCATCATTTTAAAACCATGCACCGATACACA CTGGAAATGTTCAGAACTTGCCAGTTTTGTCCTCAGTTTCGGGAGATCAT CCACAAAGCCCTCATCGACAGAAACATCCAGGCCACCCTGGAAAGCCAGA AGAAACTCAACTGGTGTCGAGAAGTCCGGAAGCTTGTGGCGCTGAAAACG AACGGTGACGGCAATTGCCTCATGCATGCCACTTCTCAGTACATGTGGGG CGTTCAGGACACAGACTTGGTACTGAGGAAGGCGCTGTTCAGCACGCTCA AGGAAACAGACACACGCAACTTTAAATTCCGCTGGCAACTGGAGTCTCTC AAATCTCAGGAATTTGTTGAAACGGGGCTTTGCTATGATACTCGGAACTG GAATGATGAATGGGACAATCTTATCAAAATGGCTTCCACAGACACACCCA TGGCCCGAAGTGGACTTCAGTACAACTCACTGGAAGAAATACACATATTT GTCCTTTGCAACATCCTCAGAAGGCCAATCATTGTCATTTCAGACAAAAT GCTAAGAAGTTTGGAATCAGGTTCCAATTTCGCCCCTTTGAAAGTGGGTG GAATTTACTTGCCTCTCCACTGGCCTGCCCAGGAATGCTACAGATACCCC ATTGTTCTCGGCTATGACAGCCATCATTTTGTACCCTTGGTGACCCTGAA GGACAGTGGGCCTGAAATCCGAGCTGTTCCACTTGTTAACAGAGACCGGG GAAGATTTGAAGACTTAAAAGTTCACTTTTTGACAGATCCTGAAAATGAG ATGAAGGAGAAGCTCTTAAAAGAGTACTTAATGGTGATAGAAATCCCCGT CCAAGGCTGGGACCATGGCACAACTCATCTCATCAATGCCGCAAAGTTGG ATGAAGCTAACTTACCAAAAGAAATCAATCTGGTAGATGATTACTTTGAA CTTGTTCAGCATGAGTACAAGAAATGGCAGGAAAACAGCGAGCAGGGGAG GAGAGAGGGGCACGCCCAGAATCCCATGGAACCTTCCGTGCCCCAGCTTT CTCTCATGGATGTAAAATGTGAAACGCCCAACTGCCCCTTCTTCATGTCT GTGAACACCCAGCCTTTATGCCATGAGTGCTCAGAGAGGCGGCAAAAGAA TCAAAACAAACTCCCAAAGCTGAACTCCAAGCCGGGCCCTGAGGGGCTCC CTGGCATGGCGCTCGGGGCCTCTCGGGGAGAAGCCTATGAGCCCTTGGCG TGGAACCCTGAGGAGTCCACTGGGGGGCCTCATTCGGCCCCACCGACAGC ACCCAGCCCTTAACTGTTCAGTGAGACCACTGCCATGAAGTGCAGGAGCC CCGGCTGCCCCTTCACACTGAATGTGCAGCACAACGGATTTTGTGAACGT TGCCACAACGCCCGGCAACTTCACGCCAGCCACGCCCCAGACCACACAAG GCACTTGGATCCCGGGAAGTGCCAAGCCTGCCTCCAGGATGTTACCAGGA CATTTAATGGGATCTGCAGTACTTGCTTCAAAAGGACTACAGCAGAGGCC TCCTCCAGCCTCAGCACCAGCCTCCCTCCTTCCTGTCACCAGCGTTCCAA GTCAGATCCCTCGCGGCTCGTCCGGAGCCCCTCCCCGCATTCTTGCCACA GAGCTGGAAACGACGCCCCTGCTGGCTGCCTGTCTCAAGCTGCACGGACT CCTGGGGACAGGACGGGGACGAGCAAGTGCAGAAAAGCCGGCTGCGTGTA TTTTGGGACTCCAGAAAACAAGGGCTTTTGCACACTGTGTTTCATCGAGT ACAGAGAAAACAAACATTTTGCTGCTGCCTCAGGGAAAGTCAGTCCCACA GCGTCCAGGTTCCAGAACACCATTCCGTGCCTGGGGAGGGAATGCGGCAC CCTTGGAAGCACCATGTTTGAAGGATACTGCCAGAAGTGTTTCATTGAAG CTCAGAATCAGAGATTTCATGAGGCCAAAAGGACAGAAGAGCAACTGAGA TCGAGCCAGCGCAGAGATGTGCCTCGAACCACACAAAGCACCTCAAGGCC CAAGTGCGCCCGGGCCTCCTGCAAGAACATCCTGGCCTGCCGCAGCGAGG AGCTCTGCATGGAGTGTCAGCATCCCAACCAGAGGATGGGCCCTGGGGCC CACCGGGGTGAGCCTGCCCCCGAAGACCCCCCCAAGCAGCGTTGCCGGGC CCCCGCCTGTGATCATTTTGGCAATGCCAAGTGCAACGGCTACTGCAACG AATGCTTTCAGTTCAAGCAGATGTATGGCTAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MDYKDDDDKGIPGIPGSTRAAAMAEQVLPQALYLSNMRKAVKIRERTPED IFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLE SQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFS TLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTD TPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLK VGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNR DRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAA KLDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRREGHAQNPMEPSVP QLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPKLNSKPGPE GLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSP*
Antibiotic:
Amp
Comments:
N ter FLAG for mammalian expression Estimated MW of expressed protein : 56129 Daltons

Do you need any help? Please get in touch and we’ll be happy to lend a hand.