cDNA Clone - ABIN1 (mouse)

Name: ABIN1 (mouse)
Price per aliquot: £110.00
Expressed:
GST-ABIN1 1-560
Plasmid:
pGEX6P-1-ABIN1 (mouse) 1-560
Parent Plasmid:
pGEX6P1
View Parent Plasmid

Snapgene File | Genbank File
ACGTTATCGACTGCACGGTGCACCAATGCTTCTGGCGTCAGGCAGCCATCGGAAGCTGTGGTATGGCTGTGCAGGTCGTAAATCACTGCATAATTCGTGTCGCTCAAGGCGCACTCCCGTTCTGGATAATGTTTTTTGCGCCGACATCATAACGGTTCTGGCAAATATTCTGAAATGAGCTGTTGACAATTAATCATCGGCTCGTATAATGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGTATTCATGTCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCACTCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATGAGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTGGAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACAGTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTGGTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTGGATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAACTCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCGAAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCATCCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCCAATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTGAAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCATGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCCAAAATCGGATCTGGAAGTTCTGTTCCAGGGGCCCCTGGGATCCCCGGAATTCCCGGGTCGACTCGAGCGGCCGCATCGTGACTGACTGACGATCTGCCTCGCGCGTTTCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACGGTCACAGCTTGTCTGTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGGCGCGTCAGCGGGTGTTGGCGGGTGTCGGGGCGCAGCCATGACCCAGTCACGTAGCGATAGCGGAGTGTATAATTCTTGAAGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGGTTTCTTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATAAATTCCGACACCATCGAATGGTGCAAAACCTTTCGCGGTATGGCATGATAGCGCCCGGAAGAGAGTCAATTCAGGGTGGTGAATGTGAAACCAGTAACGTTATACGATGTCGCAGAGTATGCCGGTGTCTCTTATCAGACCGTTTCCCGCGTGGTGAACCAGGCCAGCCACGTTTCTGCGAAAACGCGGGAAAAAGTGGAAGCGGCGATGGCGGAGCTGAATTACATTCCCAACCGCGTGGCACAACAACTGGCGGGCAAACAGTCGTTGCTGATTGGCGTTGCCACCTCCAGTCTGGCCCTGCACGCGCCGTCGCAAATTGTCGCGGCGATTAAATCTCGCGCCGATCAACTGGGTGCCAGCGTGGTGGTGTCGATGGTAGAACGAAGCGGCGTCGAAGCCTGTAAAGCGGCGGTGCACAATCTTCTCGCGCAACGCGTCAGTGGGCTGATCATTAACTATCCGCTGGATGACCAGGATGCCATTGCTGTGGAAGCTGCCTGCACTAATGTTCCGGCGTTATTTCTTGATGTCTCTGACCAGACACCCATCAACAGTATTATTTTCTCCCATGAAGACGGTACGCGACTGGGCGTGGAGCATCTGGTCGCATTGGGTCACCAGCAAATCGCGCTGTTAGCGGGCCCATTAAGTTCTGTCTCGGCGCGTCTGCGTCTGGCTGGCTGGCATAAATATCTCACTCGCAATCAAATTCAGCCGATAGCGGAACGGGAAGGCGACTGGAGTGCCATGTCCGGTTTTCAACAAACCATGCAAATGCTGAATGAGGGCATCGTTCCCACTGCGATGCTGGTTGCCAACGATCAGATGGCGCTGGGCGCAATGCGCGCCATTACCGAGTCCGGGCTGCGCGTTGGTGCGGATATCTCGGTAGTGGGATACGACGATACCGAAGACAGCTCATGTTATATCCCGCCGTCAACCACCATCAAACAGGATTTTCGCCTGCTGGGGCAAACCAGCGTGGACCGCTTGCTGCAACTCTCTCAGGGCCAGGCGGTGAAGGGCAATCAGCTGTTGCCCGTCTCACTGGTGAAAAGAAAAACCACCCTGGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGGATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCGCTTTGCCTGGTTTCCGGCACCAGAAGCGGTGCCGGAAAGCTGGCTGGAGTGCGATCTTCCTGAGGCCGATACTGTCGTCGTCCCCTCAAACTGGCAGATGCACGGTTACGATGCGCCCATCTACACCAACGTAACCTATCCCATTACGGTCAATCCGCCGTTTGTTCCCACGGAGAATCCGACGGGTTGTTACTCGCTCACATTTAATGTTGATGAAAGCTGGCTACAGGAAGGCCAGACGCGAATTATTTTTGATGGCGTTGGAATT
DU Number:
DU12906
Genbank:
Species:
Mouse
Synonyms:
TNIP1
Sequence of Insert:
View Sequence

GGATCCATGGAAGGGAGAGGACCCTACCGGATCTACGACCCAGGGGGCAG CACGCCTCTGGGAGAGGTGTCCGCAGCTTTTGAACGTCTAGTGGAGGAGA ATACTCGGCTGAAGGGAAAAATGCAAGGGATAAAGATGTTAGGGGAGCTT CTGGAGGAGTCTCAGATGGAAGCGTCCAGACTCCGGCAGAAGGCAGAGGA GCTGGTCAAGGACAGCGAGCTGTCACCACCGACATCTGCCCCCTCCTTGG TCTCCTTTGATGACCTGGCTGAGCTCACAGGACAGGATACAAAGGTCCAG GTACATCCTGCTACCAGCACTGCCGCCACCACCACCGCCACCGCCACCAC GGGAAACTCCATGGAGAAGCCCGAGCCAGCCTCCAAATCTCCGTCCAATG GCGCCTCCTCGGACTTTGAAGTGGTCCCTACTGAGGAGCAGAATTCACCC GAAACTGGCAGCCACCCTACGAACATGATGGACCTGGGGCCCCCACCCCC AGAGGACAGCAACCTGAAGCTCCACCTGCAGCGCCTGGAGACCACCCTTA GCGTGTGTGCAGAGGAGCCAGACCACAGCCAGCTCTTCACCCACCTGGGC CGCATGGCCCTCGAGTTCAACAGGTTGGCCTCCAAAGTGCATAAAAATGA GCAGCGCACCTCCATCCTGCAGACCTTATGTGAGCAGCTGCGCCAGGAGA ATGAAGCCCTGAAGGCCAAGCTGGACAAGGGCCTGGAACAGCGGGATCTG GCTGCTGAGAGGCTGCGGGAGGAAAACACGGAGCTCAAGAAACTGTTGAT GAACAGCAGCTGCAAAGAGGGACTCTGTGGGCAGCCCAGCTCCCCAAAGC CAGAGGGTGCTGGCAAGAAGGGCGTGGCTGGACAGCAGCAGGCCAGTGTG ATGGCGAGTAAAGTCCCTGAAGCGGGGGCCTTTGGAGCAGCTGAGAAGAA AGTGAAGTTGCTAGAACAGCAACGCATGGAGCTGCTGGAAGTGAACAAGC AGTGGGACCAGCATTTCCGGTCCATGAAGCAGCAGTATGAGCAGAAGATC ACAGAGCTTCGCCAGAAGCTGGTGGACCTGCAGAAACAGGTAACTGAGCT GGAGGCCGAACGGGAGCAGAAGCAGCGTGACTTTGACCGGAAACTCCTCC TGGCCAAATCGAAGATAGAGATGGAAGAGACCGACAAGGAGCAGCTGACA GCAGAGGCCAAGGAACTGCGCCAGAAGGTCAGGTACCTACAGGATCAGCT GAGCCCGCTCACAAGGCAACGAGAATACCAGGAGAAGGAGATCCAGCGGC TCAATAAGGCCCTGGAGGAGGCCCTCAGCATCCAGGCCTCTCCATCATCT CCGCCTGCAGCTTTTGGGAGTCCAGAAGGCGTTGGGGGCCATCTGAGGAA GCAGGAACTAGTGACACAGAATGAGTTGCTGAAACAGCAGGTAAAGATCT TTGAAGAGGACTTCCAGAGGGAACGGAGTGACCGTGAACGCATGAATGAA GAGAAGGAGGAGCTGAAGAAGCAAGTAGAGAAGCTGCAGGCCCAGGTCAC CCTGACTAATGCCCAGCTCAAAACTCTCAAAGAGGAGGAGAAGGCCAAGG AAGCCCTCAAACAGCAGAAGAGGAAAGCAAAGGCTTCGGGAGAGCGCTAC CACATGGAACCCCACCCTGAGCACGTCTGCGGCGCCTAACCCTATGCCTA CCCACCCATGCCAGCCATGGTACCTCACCATGCCTACAATGACTGTGATG GGCCCCAGTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMEGRGPYRIYDPGGSTPLG EVSAAFERLVEENTRLKGKMQGIKMLGELLEESQMEASRLRQKAEELVKD SELSPPTSAPSLVSFDDLAELTGQDTKVQVHPATSTAATTTATATTGNSM EKPEPASKSPSNGASSDFEVVPTEEQNSPETGSHPTNMMDLGPPPPEDSN LKLHLQRLETTLSVCAEEPDHSQLFTHLGRMALEFNRLASKVHKNEQRTS ILQTLCEQLRQENEALKAKLDKGLEQRDLAAERLREENTELKKLLMNSSC KEGLCGQPSSPKPEGAGKKGVAGQQQASVMASKVPEAGAFGAAEKKVKLL EQQRMELLEVNKQWDQHFRSMKQQYEQKITELRQKLVDLQKQVTELEAER EQKQRDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVRYLQDQLSPLT RQREYQEKEIQRLNKALEEALSIQASPSSPPAAFGSPEGVGGHLRKQELV TQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLTNA QLKTLKEEEKAKEALKQQKRKAKASGERYHMEPHPEHVCGA*
Antibiotic:
Amp
Comments:
N ter GST for bacterial expression. Estimated MW of expressed protein : 89924 Daltons

Do you need any help? Please get in touch and we’ll be happy to lend a hand.