cDNA Clone - ABIN1

Name: ABIN1
Price per aliquot: £110.00
Expressed:
GFP-TAP-ABIN1
Plasmid:
pLent tap ABIN1
Parent Plasmid:
pLent TAP
View Parent Plasmid

|
DU Number:
DU8787
Genbank:
Species:
Human
Synonyms:
TNIP1
Sequence of Insert:
View Sequence

ACTAGTATGGAAGGGAGAGGACCGTACCGGATCTACGACCCTGGGGGCAG CGTGCCCTCAGGAGAGGCATCCGCAGCTTTTGAGCGCCTAGTGAAGGAGA ATTCCCGGCTGAAGGAAAAAATGCAAGGGATAAAGATGTTAGGGGAGCTT TTGGAAGAGTCCCAGATGGAAGCGACCAGGCTCCGGCAGAAGGCAGAGGA GCTAGTGAAGGACAACGAGCTGCTCCCACCACCTTCTCCCTCCTTGGGCT CCTTCGACCCCCTGGCTGAGCTCACAGGAAAGGACTCAAATGTCACAGCA TCTCCCACAGCCCCTGCATGCCCCAGTGACAAGCCAGCACCAGTCCAGAA GCCTCCATCCAGTGGCACCTCCTCTGAATTTGAAGTGGTCACTCCTGAGG AGCAGAATTCACCAGAGAGCAGCAGCCATGCCAATGCGATGGCGCTGGGC CCCCTGCCCCGTGAGGACGGCAACCTGATGCTGCACCTGCAGCGCCTGGA GACCACGCTGAGTGTGTGTGCCGAGGAGCCGGACCACGGCCAGCTCTTCA CCCACCTGGGCCGCATGGCCCTGGAGTTCAACCGACTGGCATCCAAGGTG CACAAGAATGAGCAGCGCACCTCCATTCTGCAGACCCTGTGTGAGCAGCT TCGGAAGGAGAACGAGGCTCTGAAGGCCAAGTTGGATAAGGGCCTGGAAC AGCGGGATCAGGCTGCCGAGAGGCTGCGGGAGGAAAATTTGGAGCTCAAG AAGTTGTTGATGAGCAATGGCAACAAAGAGGGTGCGTCTGGGCGGCCAGG CTCACCGAAGATGGAAGGGACAGGCAAGAAGGCAGTGGCTGGACAGCAGC AGGCTAGTGTGACGGCAGGTAAGGTCCCAGAGGTGGTGGCCTTGGGCGCA CCCGAGAAGAAGGTGAAGATGCTGGAGCAGCAGCGCAGTGAGCTGCTGGA AGTGAACAAGCAGTGGGACCAGCATTTCCGGTCCATGAAGCAGCAGTATG AGCAGAAGATCACTGAGCTGCGTCAGAAGCTGGCTGATTTGCAGAAGCAG GTGACTGACCTGGAGGCCGAGCGGGAGCAGAAGCAGCGTGACTTTGACCG CAAGCTCCTCCTGGCCAAGTCCAAGATTGAAATGGAGGAGACCGACAAGG AGCAGCTGACAGCAGAGGCCAAGGAGCTGCGCCAAAAGGTCAAGTACCTG CAGGATCAGCTGAGCCCACTCACCCGACAGCGTGAGTACCAGGAAAAGGA GATCCAGCGGCTCAACAAGGCCCTGGAGGAAGCACTGAGCATCCAAACCC CGCCATCATCTCCACCAACAGCATTTGGGAGCCCAGAAGGAGCAGGGGCC CTCCTAAGGAAACAGGAGCTGGTCACGCAGAATGAGTTGCTGAAACAGCA GGTGAAGATCTTCGAGGAGGACTTCCAGAGGGAGCGCAGTGATCGTGAGC GCATGAATGAGGAGAAGGAAGAGCTGAAGAAGCAAGTGGAGAAGCTGCAG GCCCAGGTCACCCTGTCAAATGCCCAGCTAAAAGCATTCAAAGATGAGGA GAAGGCAAGAGAAGCCCTCAGACAGCAGAAGAGGAAAGCAAAGGCCTCAG GAGAGCGTTACCATGTGGAGCCCCACCCAGAACATCTCTGCGGGGCCTAC CCCTACGCCTACCCGCCCATGCCAGCCATGGTGCCACACCATGGCTTCGA GGACTGGTCCCAGATCCGCTACCCCCCTCCCCCCATGGCCATGGAGCACC CGCCCCCACTCCCCAACTCGCGCCTCTTCCATCTGCCGGAATACACCTGG CGTCTACCTTGTGGAGGGGTTCGAAATCCAAATCAGAGCTCCCAAGTGAT GGACCCTCCCACAGCCAGGCCTACAGAACCAGAGTCTCCAAAAAATGACC GTGAGGGGCCTCAGTGAACTAGT
Amino Acid Sequence:
View Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGRTQISSSSF DIALATMDTSAHDEAVDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLK DDPSQSANLLAEAKKLNDAQAPKVDNKFNKERQNAFYEILHLPNLNEEQR NAFIQSLKDDPSQSANLLAEAKKLNDAQAPKVDASWSAGASENLYFQGGR SMEKRRWKKNFIAVSAANRFKKISSSGALDYDIPTALEVLFQGPLTSMEG RGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQ MEATRLRQKAEELVKDNELLPPPSPSLGSFDPLAELTGKDSNVTASPTAP ACPSDKPAPVQKPPSSGTSSEFEVVTPEEQNSPESSSHANAMALGPLPRE DGNLMLHLQRLETTLSVCAEEPDHGQLFTHLGRMALEFNRLASKVHKNEQ RTSILQTLCEQLRKENEALKAKLDKGLEQRDQAAERLREENLELKKLLMS NGNKEGASGRPGSPKMEGTGKKAVAGQQQASVTAGKVPEVVALGAPEKKV KMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVTDLE AEREQKQRDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLS PLTRQREYQEKEIQRLNKALEEALSIQTPPSSPPTAFGSPEGAGALLRKQ ELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTL SNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEPHPEHLCGAYPYAYP PMPAMVPHHGFEDWSQIRYPPPPMAMEHPPPLPNSRLFHLPEYTWRLPCG GVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ*
Antibiotic:
Amp
Comments:
N ter GFP TAP for mammalian expression. Estimated MW of expressed protein : 121970 Daltons

Do you need any help? Please get in touch and we’ll be happy to lend a hand.