cDNA Clone - A20 (mouse)

Name: A20 (mouse)
Price per aliquot: £110.00
Expressed:
GST-A20 (mouse)
Plasmid:
pEBG6P-A20 (mouse)
Parent Plasmid:
pEBG6P
View Parent Plasmid

Snapgene File | Genbank File
AGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTTCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCATAGTCCCGCCCCTAACTCCGCCCATCCCGCCCCTAACTCCGCCCAGTTCCGCCCATTCTCCGCCCCATGGCTGACTAATTTTTTTTATTTATGCAGAGGCCGAGGCCGCCTCGGCCTCTGAGCTATTCCAGAAGTAGTGAGGAGGCTTTTTTGGAGGCCTAGGCTTTTGCAAAAAGCTTTGCAAAGATGGATAAAGTTTTAAACAGAGAGGAATCTTTGCAGCTAATGGACCTTCTAGGTCTTGAAAGGAGTGGGAATTGGCTCCGGTGCCCGTCAGTGGGCAGAGCGCACATCGCCCACAGTCCCCGAGAAGTTGGGGGGAGGGGTCGGCAATTGAACCGGTGCCTAGAGAAGGTGGCGCGGGGTAAACTGGGAAAGTGATGTCGTGTACTGGCTCCGCCTTTTTCCCGAGGGTGGGGGAGAACCGTATATAAGTGCAGTAGTCGCCGTGAACGTTCTTTTTCGCAACGGGTTTGCCGCCAGAACACAGGTAAGTGCCGTGTGTGGTTCCCGCGGGCCTGGCCTCTTTACGGGTTATGGCCCTTGCGTGCCTTGAATTACTTCCACGCCCCTGGCTGCAGTACGTGATTCTTGATCCCGAGCTTCGGGTTGGAAGTGGGTGGGAGAGTTCGAGGCCTTGCGCTTAAGGAGCCCCTTCGCCTCGTGCTTGAGTTGAGGCCTGGCCTGGGCGCTGGGGCCGCCGCGTGCGAATCTGGTGGCACCTTCGCGCCTGTCTCGCTGCTTTCGATAAGTCTCTAGCCATTTAAAATTTTTGATGACCTGCTGCGACGCTTTTTTTCTGGCAAGATAGTCTTGTAAATGCGGGCCAAGATCTGCACACTGGTATTTCGGTTTTTGGGGCCGCGGGCGGCGACGGGGCCCGTGCGTCCCAGCGCACATGTTCGGCGAGGCGGGGCCTGCGAGCGCGGCCACCGAGAATCGGACGGGGGTAGTCTCAAGCTGGCCGGCCTGCTCTGGTGCCTGGCCTCGCGCCGCCGTGTATCGCCCCGCCCTGGGCGGCAAGGCTGGCCCGGTCGGCACCAGTTGCGTGAGCGGAAAGATGGCCGCTTCCCGGCCCTGCTGCAGGGAGCTCAAAATGGAGGACGCGGCGCTCGGGAGAGCGGGCGGGTGAGTCACCCACACAAAGGAAAAGGGCCTTTCCGTCCTCAGCCGTCGCTTCATGTGACTCCACGGAGTACCGGGCGCCGTCCAGGCACCTCGATTAGTTCTCGAGCTTTTGGAGTACGTCGTCTTTAGGTTGGGGGGAGGGGTTTTATGCGATGGAGTTTCCCCACACTGAGTGGGTGGAGACTGAAGTTAGGCCAGCTTGGCACTTGATGTAATTCTCCTTGGAATTTGCCCTTTTTGAGTTTGGATCTTGGTTCATTCTCAAGCCTCAGACAGTGGTTCAAAGTTTTTTTCTTCCATTTCAGGTGTCGTGAGGAATTCTCTAGAGATCCCTCGACCTCGAGATCCATTGTGCTGGATCTACAATGGCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCACTCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATGAGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTGGAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACAGTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTGGTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTGGATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAACTCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCGAAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCATCCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCCAATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTGAAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCATGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCCAAAATCGGATCTGGTTCCGCGTGGATCTCTGGAAGTTCTGTTCCAGGGGCCCCTGGGATCCACTAGTGGTACCATCGATGCGGCCGCGACTCTAGAGTGAGGGTCCCCACCTGGGACCCTTGAGAGTATCAGGTCTCCCACGTGGGAGACAAGAAATCCCTGTTTAATATTTAAACAGCAGTGTTCCCCATCTGGGTCCTTGCACCCCTCACTCTGGCCTCAGCCGACTGCACAGCGGCCCCTGCATCCCCTTGGCTGTGAGGCCCCTGGACAAGCAGAGGTGGCCAGAGCTGGGAGGCATGGCCCTGGGGTCCCACGAATTTGCTGGGGAATCTCGTTTTTCTTCTTAAGACTTTTGGGACATGGTTTGACTCCCGAACATCACCGACGCGTCTCCTGTTTTTCTGGGTGGCCTCGGGACACCTGCCCTGCCCCCACGAGGGTCAGGACTGTGACTCTTTTTAGGGCCAGGCAGGTGCCTGGACATTTGCCTTGCTGGACGGGGACTGGGGATGTGGGAGGGAGCAGACAGGAGGAATCATGTCAGGCCTGTGTGTGAAAGGAAGCTCCACTGTCACCCTCCACCTCTTCACCCCCCACTCACCAGTGTCCCCTCCACTGTCACATTGTAACTGAACTTCAGGATAATAAAGTGTTTGCCTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATACGTCAAAGCAACCATAGTACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTTGGGTGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGGCTATTCTTTTGATTTATAAGGGATTTTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTAACAAAAATTTAACGCGAATTTTAACAAAATATTAACGTTTACAATTTTATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGCCCCGACACCCGCCAACACCCGCTGACGCGCCCTGACGGGCTTGTCTGCTCCCGGCATCCGCTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGCATGTGTCAGAGGTTTTCACCGTCATCACCGAAACGCGCGAGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGGTTTCTTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTATTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGTAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGC
DU Number:
DU8429
Genbank:
Species:
Mouse
Sequence of Insert:
View Sequence

GGATCCATGGCTGAACAACTTCTTCCTCAGGCTTTGTATTTGAGCAATAT GCGGAAAGCTGTGAAGATACGAGAGAGAACCCCAGAAGACATTTTCAAAC CTACCAATGGGATCATCTATCACTTTAAAACCATGCACCGATACACGCTG GAGATGTTCAGAACATGCCAGTTTTGCCCACAGTTCCGAGAGATCATCCA CAAAGCACTTATTGACAGAAGTGTCCAGGCTTCCCTGGAAAGCCAGAAGA AGCTCAACTGGTGTCGTGAAGTCAGGAAGCTCGTGGCTCTGAAAACCAAT GGTGATGGAAACTGCCTCATGCATGCAGCTTGTCAGTACATGTGGGGTGT TCAGGATACTGACCTGGTCCTGAGGAAGGCCCTCTGCAGCACCCTTAAGG AGACAGACACTCGGAACTTTAAATTCCGCTGGCAGCTGGAATCTCTGAAA TCTCAGGAATTTGTGGAAACAGGACTTTGCTACGACACTCGGAACTGGAA TGACGAATGGGACAACTTGGTCAAAATGGCATCAGCAGACACACCTGCAG CCCGAAGTGGACTTCAGTACAATTCCCTGGAAGAAATCCACATATTTGTC CTCAGCAACATCCTCAGAAGACCCATCATTGTCATTTCAGACAAAATGCT AAGAAGTTTGGAATCTGGTTCCAATTTTGCTCCTTTGAAAGTGGGTGGGA TTTATCTGCCTCTTCACTGGCCTGCCCAGGAGTGTTACAGATATCCCATC GTCCTAGGCTATGACAGCCAGCACTTTGTACCCCTGGTGACCCTGAAGGA CAGTGGACCTGAACTTCGCGCTGTTCCACTTGTTAACAGAGACCGGGGTA GGTTTGAAGACTTAAAAGTTCACTTCTTGACAGATCCTGAGAATGAGATG AAGGAAAAGCTTCTAAAGGAGTACTTGATAGTGATGGAGATCCCTGTGCA AGGCTGGGACCACGGCACGACTCACCTGATCAACGCTGCAAAATTGGATG AAGCTAACTTACCCAAAGAAATAAATTTGGTAGACGATTACTTTGAGCTT GTTCAGCACGAATACAAGAAATGGCAGGAGAACAGCGATCAGGCCAGGAG AGCGGCACATGCGCAGAACCCCTTGGAGCCTTCCACACCCCAGCTATCAC TCATGGATATAAAATGTGAGACACCCAACTGTCCTTTCTTCATGTCCGTG AACACTCAGCCTTTATTCCACGAATGCTCAGAGAGGCGCCAAAAGAATCA GAGCAAGCTCCCAAAGCTGAACTCGAAGCTAGGCCCTGAAGGACTCCCAG GCGTGGGACTTGGCTCCTCAAACTGGAGCCCCGAGGAAACCGCTGGAGGA CCTCATTCAGCCCCACCCACAGCACCCAGCCTTTTTCTCTTCAGTGAGAC CACTGCAATGAAGTGCAGGAGTCCTGGGTGCCCTTTTACTTTGAATGTGC AGCATAATGGATTCTGTGAGCGTTGCCACGCCCGGCAGATTAATGCCAGC CACACCGCAGACCCTGGAAAGTGCCAAGCCTGCCTTCAGGATGTCACTCG GACCTTTAATGGCATCTGCAGTACCTGTTTCAAAAGGACTACAGCAGAGC CCAGCTCCAGCCTCACTTCCAGTATCCCTGCCTCCTGTCACCAACGCTCC AAGTCTGACCCCTCACAACTCATCCAAAGTCTCACTCCACACTCTTGCCA CCGGACTGGAAATGTCTCTCCTTCTGGCTGCCTCTCCCAGGCTGCACGGA CTCCAGGAGACAGAGCAGGGACAAGCAAGTGCAGGAAAGCTGGCTGCATG TATTTTGGGACTCCAGAAAACAAGGGCTTTTGCACTCTATGTTTCATCGA ATACAGAGAAAATAAGCAGTCTGTTACTGCCTCTGAGAAAGCTGGTTCCC CGGCCCCCAGGTTCCAGAACAATGTCCCGTGCCTGGGCAGGGAGTGCGGC ACACTCGGAAGCACCATGTTTGAAGGGTACTGTCAGAAGTGTTTCATCGA AGCTCAGAACCAGAGATTCCATGAAGCAAGAAGAACGGAAGAACAGCTGA GATCAAGCCAGCATAGAGACATGCCTCGAACTACACAGGTAGCCTCAAGG CTGAAATGTGCCCGGGCCTCCTGCAAGAACATTCTGGCCTGTCGCAGTGA GGAACTCTGTATGGAGTGCCAGCACCTAAGCCAACGAGTAGGTTCTGTGG CCCACCGGGGTGAGCCCACGCCTGAAGAGCCCCCTAAACAGCGCTGCCGG GCCCCTGCTTGTGATCACTTTGGCAATGCCAAGTGTAATGGTTACTGCAA TGAGTGCTACCAGTTCAAGCAGATGTATGGCTAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLVPRGSLEVLFQGPLGSMAEQLLPQALYLS NMRKAVKIRERTPEDIFKPTNGIIYHFKTMHRYTLEMFRTCQFCPQFREI IHKALIDRSVQASLESQKKLNWCREVRKLVALKTNGDGNCLMHAACQYMW GVQDTDLVLRKALCSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRN WNDEWDNLVKMASADTPAARSGLQYNSLEEIHIFVLSNILRRPIIVISDK MLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSQHFVPLVTL KDSGPELRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLIVMEIP VQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENSDQA RRAAHAQNPLEPSTPQLSLMDIKCETPNCPFFMSVNTQPLFHECSERRQK NQSKLPKLNSKLGPEGLPGVGLGSSNWSPEETAGGPHSAPPTAPSLFLFS ETTAMKCRSPGCPFTLNVQHNGFCERCHARQINASHTADPGKCQACLQDV TRTFNGICSTCFKRTTAEPSSSLTSSIPASCHQRSKSDPSQLIQSLTPHS CHRTGNVSPSGCLSQAARTPGDRAGTSKCRKAGCMYFGTPENKGFCTLCF IEYRENKQSVTASEKAGSPAPRFQNNVPCLGRECGTLGSTMFEGYCQKCF IEAQNQRFHEARRTEEQLRSSQHRDMPRTTQVASRLKCARASCKNILACR SEELCMECQHLSQRVGSVAHRGEPTPEEPPKQRCRAPACDHFGNAKCNGY CNECYQFKQMYG*
Antibiotic:
Amp
Comments:
N terminal GST for mammalian expression. Estimated MW of expressed protein : 115112 Daltons

Do you need any help? Please get in touch and we’ll be happy to lend a hand.