cDNA Clone - 53BP1

Name: 53BP1
Price per aliquot: £110.00
Expressed:
mCherry 53BP1
Plasmid:
pcDNA5-FRT/TO-mCherry 53BP1
Parent Plasmid:
pcDNA5 FRT/TO mCherry
View Parent Plasmid

Snapgene File | Genbank File
GACGGATCGGGAGATCTCCCGATCCCCTATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGTATCTGCTCCCTGCTTGTGTGTTGGAGGTCGCTGAGTAGTGCGCGAGCAAAATTTAAGCTACAACAAGGCAAGGCTTGACCGACAATTGCATGAAGAATCTGCTTAGGGTTAGGCGTTTTGCGCTGCTTCGCGATGTACGGGCCAGATATACGCGTTGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCTCCCTATCAGTGATAGAGATCTCCCTATCAGTGATAGAGATCGTCGACGAGCTCGTTTAGTGAACCGTCAGATCGCCTGGAGACGCCATCCACGCTGTTTTGACCTCCATAGAAGACACCGGGACCGATCCAGCCTCCGGACTCTAGCGTTTAAACTTAAGGCCACCATGGTGAGCAAGGGCGAGGAGGATAACATGGCCATCATCAAGGAGTTCATGCGCTTCAAGGTGCACATGGAGGGCTCCGTGAACGGCCACGAGTTCGAGATCGAGGGCGAGGGCGAGGGCCGCCCCTACGAGGGCACCCAGACCGCCAAGCTGAAGGTGACCAAGGGTGGCCCCCTGCCCTTCGCCTGGGACATCCTGTCCCCTCAGTTCATGTACGGCTCCAAGGCCTACGTGAAGCACCCCGCCGACATCCCCGACTACTTGAAGCTGTCCTTCCCCGAGGGCTTCAAGTGGGAGCGCGTGATGAACTTCGAGGACGGCGGCGTGGTGACCGTGACCCAGGACTCCTCCCTGCAGGACGGCGAGTTCATCTACAAGGTGAAGCTGCGCGGCACCAACTTCCCCTCCGACGGCCCCGTAATGCAGAAGAAGACCATGGGCTGGGAGGCCTCCTCCGAGCGGATGTACCCCGAGGACGGCGCCCTGAAGGGCGAGATCAAGCAGAGGCTGAAGCTGAAGGACGGCGGCCACTACGACGCTGAGGTCAAGACCACCTACAAGGCCAAGAAGCCCGTGCAGCTGCCCGGCGCCTACAACGTCAACATCAAGTTGGACATCACCTCCCACAACGAGGACTACACCATCGTGGAACAGTACGAACGCGCCGAGGGCCGCCACTCCACCGGCGGCATGGACGAGCTGTACAAGTCCGGACTCGGATCCTCTAGAAAAGGTACCATCGATGCGGCCGCTCGAGTCTAGAGGGCCCGTTTAAACCCGCTGATCAGCCTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTTCTGAGGCGGAAAGAACCAGCTGGGGCTCTAGGGGGTATCCCCACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTACCTAGAAGTTCCTATTCCGAAGTTCCTATTCTCTAGAAAGTATAGGAACTTCCTTGGCCAAAAAGCCTGAACTCACCGCGACGTCTGTCGAGAAGTTTCTGATCGAAAAGTTCGACAGCGTCTCCGACCTGATGCAGCTCTCGGAGGGCGAAGAATCTCGTGCTTTCAGCTTCGATGTAGGAGGGCGTGGATATGTCCTGCGGGTAAATAGCTGCGCCGATGGTTTCTACAAAGATCGTTATGTTTATCGGCACTTTGCATCGGCCGCGCTCCCGATTCCGGAAGTGCTTGACATTGGGGAATTCAGCGAGAGCCTGACCTATTGCATCTCCCGCCGTGCACAGGGTGTCACGTTGCAAGACCTGCCTGAAACCGAACTGCCCGCTGTTCTGCAGCCGGTCGCGGAGGCCATGGATGCGATCGCTGCGGCCGATCTTAGCCAGACGAGCGGGTTCGGCCCATTCGGACCGCAAGGAATCGGTCAATACACTACATGGCGTGATTTCATATGCGCGATTGCTGATCCCCATGTGTATCACTGGCAAACTGTGATGGACGACACCGTCAGTGCGTCCGTCGCGCAGGCTCTCGATGAGCTGATGCTTTGGGCCGAGGACTGCCCCGAAGTCCGGCACCTCGTGCACGCGGATTTCGGCTCCAACAATGTCCTGACGGACAATGGCCGCATAACAGCGGTCATTGACTGGAGCGAGGCGATGTTCGGGGATTCCCAATACGAGGTCGCCAACATCTTCTTCTGGAGGCCGTGGTTGGCTTGTATGGAGCAGCAGACGCGCTACTTCGAGCGGAGGCATCCGGAGCTTGCAGGATCGCCGCGGCTCCGGGCGTATATGCTCCGCATTGGTCTTGACCAACTCTATCAGAGCTTGGTTGACGGCAATTTCGATGATGCAGCTTGGGCGCAGGGTCGATGCGACGCAATCGTCCGATCCGGAGCCGGGACTGTCGGGCGTACACAAATCGCCCGCAGAAGCGCGGCCGTCTGGACCGATGGCTGTGTAGAAGTACTCGCCGATAGTGGAAACCGACGCCCCAGCACTCGTCCGAGGGCAAAGGAATAGCACGTACTACGAGATTTCGATTCCACCGCCGCCTTCTATGAAAGGTTGGGCTTCGGAATCGTTTTCCGGGACGCCGGCTGGATGATCCTCCAGCGCGGGGATCTCATGCTGGAGTTCTTCGCCCACCCCAACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAATTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTATCATGTCTGTATACCGTCGACCTCTAGCTAGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCCTAATGAGTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTGACGTC
DU Number:
DU33919
Genbank:
Species:
Human
Synonyms:
TP53BP1, TDRD30, TP53, p202, p53BP1
Sequence of Insert:
View Sequence

GGTACCGCCACCATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTAGAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAAGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGGGAGAAGAAGAGTTTGATATGCCTCAGCCTCCACATGGCCATGTCTTACATCGTCACATGAGAACAATCCGGGAAGTACGCACACTTGTCACTCGTGTCATTACAGATGTGTATTATGTGGATGGAACAGAAGTAGAAAGAAAAGTAACTGAGGAGACTGAAGAGCCAATTGTAGAGTGTCAGGAGTGTGAAACTGAAGTTTCCCCTTCACAGACTGGGGGCTCCTCAGGTGACCTGGGGGATATCAGCTCCTTCTCCTCCAAGGCATCCAGCTTACACCGCACATCAAGTGGGACAAGTCTCTCAGCTATGCACAGCAGTGGAAGCTCAGGGAAAGGAGCCGGACCACTCAGAGGGAAAACCAGCGGGACAGAACCCGCAGATTTTGCCTTACCCAGCTCCCGAGGAGGCCCAGGAAAACTGAGTCCTAGAAAAGGGGTCAGTCAGACAGGGACGCCAGTGTGTGAGGAGGATGGTGATGCAGGCCTTGGCATCAGACAGGGAGGGAAGGCTCCAGTCACGCCTCGTGGGCGTGGGCGAAGGGGCCGCCCACCTTCTCGGACCACTGGAACCAGAGAAACAGCTGTGCCTGGCCCCTTGGGCATAGAGGACATTTCACCTAACTTGTCACCAGATGATAAATCCTTCAGCCGTGTCGTGCCCCGAGTGCCAGACTCCACCAGACGAACAGATGTGGGTGCTGGTGCTTTGCGTCGTAGTGACTCTCCAGAAATTCCTTTCCAGGCTGCTGCTGGCCCTTCTGATGGCTTAGATGCCTCCTCTCCAGGAAATAGCTTTGTAGGGCTCCGTGTTGTAGCCAAGTGGTCATCCAATGGCTACTTTTACTCTGGGAAAATCACACGAGATGTCGGAGCTGGGAAGTATAAATTGCTCTTTGATGATGGGTACGAATGTGATGTGTTGGGCAAAGACATTCTGTTATGTGACCCCATCCCGCTGGACACTGAAGTGACGGCCCTCTCGGAGGATGAGTATTTCAGTGCAGGAGTGGTGAAAGGACATAGGAAGGAGTCTGGGGAACTGTACTACAGCATTGAAAAAGAAGGCCAAAGAAAGTGGTATAAGCGAATGGCTGTCATCCTGTCCTTGGAGCAAGGAAACAGACTGAGAGAGCAGTATGGGCTTGGCCCCTATGAAGCAGTAACACCTCTTACAAAGGCAGCAGATATCAGCTTAGACAATTTGGTGGAAGGGAAGCGGAAACGGCGCAGTAACGTCAGCTCCCCAGCCACCCCTACTGCCTCCAGTAGCAGCAGCACAACCCCTACCCGAAAGATCACAGAAAGTCCTCGTGCCTCCATGGGAGTTCTCTCAGGCAAAAGAAAACTTATCACTTCTGAAGAGGAACGGTCCCCTGCCAAGCGAGGTCGCAAGTCTGCCACAGTAAAACCTGGTGCAGTAGGGGCAGGAGAGTTTGTGAGCCCCTGTGAGAGTGGAGACAACACCGGTGAACCCTCTGCCCTGGAAGAGCAGAGAGGGCCTTTGCCTCTCAACAAGACCTTGTTTCTGGGCTACGCATTTCTCCTTACCATGGCCACAACCAGTGACAAGTTGGCCAGCCGCTCCAAACTGCCAGATGGTCCTACAGGAAGCAGTGAAGAAGAGGAGGAATTTTTGGAAATTCCTCCTTTCAACAAGCAGTATACAGAATCCCAGCTTCGAGCAGGAGCTGGCTATATCCTTGAAGATTTCAATGAAGCCCAGTGTAACACAGCTTACCAGTGTCTTCTAATTGCGGATCAGCATTGTCGAACCCGGAAGTACTTCCTGTGCCTTGCCAGTGGGATTCCTTGTGTGTCTCATGTCTGGGTCCATGATAGTTGCCATGCCAACCAGCTCCAGAACTACCGTAATTATCTGTTGCCAGCTGGGTACAGCCTTGAGGAGCAAAGAATTCTGGACTGGCAACCCCGTGAAAATCCTTTCCAGAATCTGAAGGTACTCTTGGTATCAGACCAACAGCAGAACTTCCTGGAGCTCTGGTCTGAGATCCTCATGACTGGTGGTGCAGCCTCTGTGAAGCAGCACCATTCAAGTGCCCATAACAAAGATATTGCTTTAGGGGTATTTGATGTGGTGGTGACGGACCCCTCATGCCCAGCCTCGGTGCTGAAGTGTGCTGAAGCATTGCAGCTGCCTGTGGTGTCACAAGAGTGGGTGATCCAGTGCCTCATTGTTGGGGAGAGAATTGGATTCAAGCAGCATCCAAAATATAAACACGATTATGTTTCTCACTAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKSGLGSSRKGTATMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQT HKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSG NTTHSLGAEDTASSQLGFGVLELSQSQDVEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQ NPPPARSEDMPFSPKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQ DSLSTNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPPGSLPIPS QPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDGENTQIEDTEPMS PVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEALSSVLDQEEAMEIKE HHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSE DSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTKEEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQ PQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSFCESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIAT SDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCLRMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSED PPTTPIRGNLLHFPSSQGEEEKEKLEGDHTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNI GIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRHMRTIREVRTLVTR VITDVYYVDGTEVERKVTEETEEPIVECQECETEVSPSQTGGSSGDLGDISSFSSKASSLHRTSSGTSLSAMHSSGSSGKGAGPLRGKTSGTEPADFALP SSRGGPGKLSPRKGVSQTGTPVCEEDGDAGLGIRQGGKAPVTPRGRGRRGRPPSRTTGTRETAVPGPLGIEDISPNLSPDDKSFSRVVPRVPDSTRRTDV GAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEY FSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSNVSSPATPTASSSSSTTPTRK ITESPRASMGVLSGKRKLITSEEERSPAKRGRKSATVKPGAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMATTSDKLASRSKLP DGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGY SLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLI VGERIGFKQHPKYKHDYVSH*
Antibiotic:
Amp
Comments:
Contains two silent nucleotide changes as compared to the ref sequence; G>A 1245bp and G>A 3153 bp.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.