cDNA Clone - 53BP1

Name: 53BP1
Price per aliquot: £110.00
Expressed:
GFP-53BP1-HA
Plasmid:
pcDNA5-FRT/TO-GFP 53BP1 C-HA
Parent Plasmid:
pcDNA5 FRT/TO GFP
View Parent Plasmid

Snapgene File | Genbank File
GACGGATCGGGAGATCTCCCGATCCCCTATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGTATCTGCTCCCTGCTTGTGTGTTGGAGGTCGCTGAGTAGTGCGCGAGCAAAATTTAAGCTACAACAAGGCAAGGCTTGACCGACAATTGCATGAAGAATCTGCTTAGGGTTAGGCGTTTTGCGCTGCTTCGCGATGTACGGGCCAGATATACGCGTTGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCTCCCTATCAGTGATAGAGATCTCCCTATCAGTGATAGAGATCGTCGACGAGCTCGTTTAGTGAACCGTCAGATCGCCTGGAGACGCCATCCACGCTGTTTTGACCTCCATAGAAGACACCGGGACCGATCCAGCCTCCGGACTCTAGCGTTTAAACTTAAGGCCACCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTCCGGACTCGGATCCTCTAGAAAAGGTACCATCGATGCGGCCGCTCGAGTCTAGAGGGCCCGTTTAAACCCGCTGATCAGCCTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTTCTGAGGCGGAAAGAACCAGCTGGGGCTCTAGGGGGTATCCCCACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTACCTAGAAGTTCCTATTCCGAAGTTCCTATTCTCTAGAAAGTATAGGAACTTCCTTGGCCAAAAAGCCTGAACTCACCGCGACGTCTGTCGAGAAGTTTCTGATCGAAAAGTTCGACAGCGTCTCCGACCTGATGCAGCTCTCGGAGGGCGAAGAATCTCGTGCTTTCAGCTTCGATGTAGGAGGGCGTGGATATGTCCTGCGGGTAAATAGCTGCGCCGATGGTTTCTACAAAGATCGTTATGTTTATCGGCACTTTGCATCGGCCGCGCTCCCGATTCCGGAAGTGCTTGACATTGGGGAATTCAGCGAGAGCCTGACCTATTGCATCTCCCGCCGTGCACAGGGTGTCACGTTGCAAGACCTGCCTGAAACCGAACTGCCCGCTGTTCTGCAGCCGGTCGCGGAGGCCATGGATGCGATCGCTGCGGCCGATCTTAGCCAGACGAGCGGGTTCGGCCCATTCGGACCGCAAGGAATCGGTCAATACACTACATGGCGTGATTTCATATGCGCGATTGCTGATCCCCATGTGTATCACTGGCAAACTGTGATGGACGACACCGTCAGTGCGTCCGTCGCGCAGGCTCTCGATGAGCTGATGCTTTGGGCCGAGGACTGCCCCGAAGTCCGGCACCTCGTGCACGCGGATTTCGGCTCCAACAATGTCCTGACGGACAATGGCCGCATAACAGCGGTCATTGACTGGAGCGAGGCGATGTTCGGGGATTCCCAATACGAGGTCGCCAACATCTTCTTCTGGAGGCCGTGGTTGGCTTGTATGGAGCAGCAGACGCGCTACTTCGAGCGGAGGCATCCGGAGCTTGCAGGATCGCCGCGGCTCCGGGCGTATATGCTCCGCATTGGTCTTGACCAACTCTATCAGAGCTTGGTTGACGGCAATTTCGATGATGCAGCTTGGGCGCAGGGTCGATGCGACGCAATCGTCCGATCCGGAGCCGGGACTGTCGGGCGTACACAAATCGCCCGCAGAAGCGCGGCCGTCTGGACCGATGGCTGTGTAGAAGTACTCGCCGATAGTGGAAACCGACGCCCCAGCACTCGTCCGAGGGCAAAGGAATAGCACGTACTACGAGATTTCGATTCCACCGCCGCCTTCTATGAAAGGTTGGGCTTCGGAATCGTTTTCCGGGACGCCGGCTGGATGATCCTCCAGCGCGGGGATCTCATGCTGGAGTTCTTCGCCCACCCCAACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAATTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTATCATGTCTGTATACCGTCGACCTCTAGCTAGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCCTAATGAGTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTGACGTC
DU Number:
DU19410
Genbank:
Species:
Human
Synonyms:
TP53BP1, p202
Sequence of Insert:
View Sequence

GGTACCGCCACCATGGACTACAAGGACGACGATGACAAGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTA GCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGGGAGAAGAAGAGTTTGATATGCCTCAGCCTCCACATGGCCATGTCTTACATCGTCACATGAGAACAATCCGGGAAGTACGCACACTTGTCACTCGTGTCATTACAGATGTGTATTATGTGGATGGAACAGAAGTAGAAAGAAAAGTAACTGAGGAGACTGAAGAGCCAATTGTAGAGTGTCAGGAGTGTGAAACTGAAGTTTCCCCTTCACAGACTGGGGGCTCCTCAGGTGACCTGGGGGATATCAGCTCCTTCTCCTCCAAGGCATCCAGCTTACACCGCACATCAAGTGGGACAAGTCTCTCAGCTATGCACAGCAGTGGAAGCTCAGGGAAAGGAGCCGGACCACTCAGAGGGAAAACCAGCGGGACAGAACCCGCAGATTTTGCCTTACCCAGCTCCCGAGGAGGCCCAGGAAAACTGAGTCCTAGAAAAGGGGTCAGTCAGACAGGGACGCCAGTGTGTGAGGAGGATGGTGATGCAGGCCTTGGCATCAGACAGGGAGGGAAGGCTCCAGTCACGCCTCGTGGGCGTGGGCGAAGGGGCCGCCCACCTTCTCGGACCACTGGAACCAGAGAAACAGCTGTGCCTGGCCCCTTGGGCATAGAGGACATTTCACCTAACTTGTCACCAGATGATAAATCCTTCAGCCGTGTCGTGCCCCGAGTGCCAGACTCCACCAGACGAACA GATGTGGGTGCTGGTGCTTTGCGTCGTAGTGACTCTCCAGAAATTCCTTTCCAGGCTGCTGCTGGCCCTTCTGATGGCTTAGATGCCTCCTCTCCAGGAAATAGCTTTGTAGGGCTCCGTGTTGTAGCCAAGTGGTCATCCAATGGCTACTTTTACTCTGGGAAAATCACACGAGATGTCGGAGCTGGGAAGTATAAATTGCTCTTTGATGATGGGTACGAATGTGATGTGTTGGGCAAAGACATTCTGTTATGTGACCCCATCCCGCTGGACACTGAAGTGACGGCCCTCTCGGAGGATGAGTATTTCAGTGCAGGAGTGGTGAAAGGACATAGGAAGGAGTCTGGGGAACTGTACTACAGCATTGAAAAAGAAGGCCAAAGAAAGTGGTATAAGCGAATGGCTGTCATCCTGTCCTTGGAGCAAGGAAACAGACTGAGAGAGCAGTATGGGCTTGGCCCCTATGAAGCAGTAACACCTCTTACAAAGGCAGCAGATATCAGCTTAGACAATTTGGTGGAAGGGAAGCGGAAACGGCGCAGTAACGTCAGCTCCCCAGCCACCCCTACTGCCTCCAGTAGCAGCAGCACAACCCCTACCCGAAAGATCACAGAAAGTCCTCGTGCCTCCATGGGAGTTCTCTCAGGCAAAAGAAAACTTATCACTTCTGAAGAGGAACGGTCCCCTGCCAAGCGAGGTCGCAAGTCTGCCACAGTAAAACCTGGTGCAGTAGGGGCAGGAGAGTTTGTGAGCCCCTGTGAGAGTGGAGACAACACCGGTGAACCCTCTGCCCTGGAAGAGCAGAGAGGGCCTTTGCCTCTCAACAAGACCTTGTTTCTGGGCTACGCATTTCTCCTTACCATGGCCACAACCAGTGACAAGTTGGCCAGCCGCTCCAAACTGCCAGATGGTCCTACAGGAAGCAGTGAAGAAGAGGAGGAATTTTTGGAAATTCCTCCTTTCAACAAGCAGTATACAGAATCCCAGCTTCGAGCAGGAGCTGGCTATATCCTTGAAGATTTCAATGAAGCCCAGTGTAACACAGCTTACCAGTGTCTTCTAATTGCGGATCAGCATTGTCGAACCCGGAAGTACTTCCTGTGCCTTGCCAGTGGGATTCCTTGTGTGTCTCATGTCTGGGTCCATGATAGTTGCCATGCCAACCAGCTCCAGAACTACCGTAATTATCTGTTGCCAGCTGGGTACAGCCTTGAGGAGCAAAGAATTCTGGACTGGCAACCCCGTGAAAATCCTTTCCAGAATCTGAAGGTACTCTTGGTATCAGACCAACAGCAGAACTTCCTGGAGCTCTGGTCTGAGATCCTCATGACTGGTGGTGCAGCCTCTGTGAAGCAGCACCATTCAAGTGCCCATAACAAAGATATTGCTTTAGGGGTATTTGATGTGGTGGTGACGGACCCCTCATGCCCAGCCTCGGTGCTGAAGTGTGCTGAAGCATTGCAGCTGCCTGTGGTGTCACAAGAGTGGGTGATCCAGTGCCTCATTGTTGGGGAGAGAATTGGATTCAAGCAGCATCCAAAATATAAACACGATTATGTTTCTCACTACCCATACGATGTGCCAGATTACGCCTAAGTCGAC
Amino Acid Sequence:
View Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSSRKGTA TMDYKDDDDKDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFS MLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVAD PVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQ KEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQDVEENTVPYEVD KEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQ PSKDVHVVKEQNPPPARSEDMPFSPKASVAAMEAKEQLSAQELMESGLQI QKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHL LQLSGQRSLVQDSLSTNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKP MDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTP VFPPGSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSK TSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDGE NTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDT DTRDDISILATGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEALSSV LDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHL SLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLAILDQELEHK EQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIA PEIEPCAENRLDTKEEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRAD DPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHA SQSFCESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIG ISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCLRMKL VSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICE ARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGDHTIRQSQQPMK PISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSK ALIERPSQNNIGIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQNFGK QDATVQTERGSGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRHMR TIREVRTLVTRVITDVYYVDGTEVERKVTEETEEPIVECQECETEVSPSQ TGGSSGDLGDISSFSSKASSLHRTSSGTSLSAMHSSGSSGKGAGPLRGKT SGTEPADFALPSSRGGPGKLSPRKGVSQTGTPVCEEDGDAGLGIRQGGKA PVTPRGRGRRGRPPSRTTGTRETAVPGPLGIEDISPNLSPDDKSFSRVVP RVPDSTRRTDVGAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRV VAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLD TEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLE QGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSNVSSPATPTA SSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPAKRGRKSATVKP GAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMATT SDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDF NEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQ NYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEI LMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPV VSQEWVIQCLIVGERIGFKQHPKYKHDYVSHYPYDVPDYA*
Antibiotic:
Amp
Comments:
Prone to rearrangement, grow at 30oC.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.