Transcription Factor/Regulator

ZNF592

cDNA Synonyms: 
CAMOS; SCAR5
DU Number: 
DU67253
Plasmid: 
pBabeD puro GFP ZNF592
Expressed: 
GFP-ZNF592
Genbank: 
NM_014630.2 with benign SNP S926N and one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGGGGGATATGAAAACCCCAGATTTTGATGACCTTCTGGCTGCCTTTGACATCCCAGACCCCACCAGCCTTGATGCCAAGGAGGCCATCCAGACACCCAGTGAGGAGAATGAGAGTCCCCTCAAACCTCCAGGCATATGTATGGATGAAAGTGTGTCCTTGTCTCACTCAGGATCAGCCCCCGATGTGCCGGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAGGAGTCATTTGAAGCGGAGAAAGACCACATTACTCCCAGTCTCCTACACAATGGATTCCGGGGCTCAGATCTGCCTCCAGATCCCCACAACTGTGGGAAATTTGATTCTACTTTTATGAATGGAGACAGTGCCAGGAGTTTCCCTGGCAAACTGGAGCCTCCCAAGTCAGAGCCATTACCCACCTTCAACCAGTTCAGTCCAATCTCCAGCCCAGAACCTGAGGATCCCATCAAAGATAACGGATTTGGGATAAAGCCCAAACACTCTGACAGTTATTTCCCACCCCCTCTTGGGTGCGGGGCTGTGGGAGGCCCAGTCCTGGAGGCTCTGGCTAAGTTTCCGGTTCCAGAGCTGCATATGTTTGATCATTTTTGTAAGAAAGAACCCAAGCCAGAACCCCTGCCCTTGGGGAGCCAGCAGGAACACGAGCAAAGTGGGCAGAACACAGTGGAACCTCACAAGGATCCGGATGCCACTCGATTCTTCGGGGAAGCTTTGGAGTTCAACAGCCATCCTAGCAACAGTATTGGAGAGTCCAAGGGGCTTGCCCGGGAGCTTGGTACCTGCTCATCAGTCCCCCCTAGGCAGCGTCTAAAGCCAGCTCATTCCAAGCTGTCCTCTTGTGTGGCAGCCTTGGTGGCCTTGCAGGCCAAAAGAGTGGCTAGTGTCACTAAGGAGGATCAGCCTGGCCACACAAAGGATCTCTCAGGGCCCACTAAAGAGAGTTCTAAAGGTAGCCCCAAAATGCCCAAGTCACCAAAGAGTCCCCGGAGCCCTCTGGAGGCCACTAGAAAAAGTATCAAGCCATCGGACAGCCCTCGTAGCATCTGCAGTGACAGCAGCAGCAAAGGCTCACCGTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTGAGAATCAAAACCATTAAGACATCATCAGGGGAAATCAAACGGACTGTCACAAGGATCCTGCCAGATCCTGATGATCCAAGTAAGTCCCCTGTTGGGTCACCTCTAGGGAGCGCCATTGCAGAGGCCCCCAGCGAGATGCCAGGGGATGAGGTGCCTGTGGAAGAGCACTTTCCTGAGGCAGGCACAAATTCAGGGAGCCCCCAGGGGGCCAGGAAAGGGGACGAGAGCATGACAAAGGCCAGTGACTCGTCATCTCCCAGCTGCAGTTCTGGGCCCCGGGTCCCAAAGGGGGCTGCCCCAGGCTCACAGACAGGCAAGAAGCAACAGAGCACAGCACTGCAGGCATCCACCCTGGCCCCTGCCAACCTCCTGCCCAAAGCCGTGCACTTGGCCAACCTGAACCTCGTCCCCCACAGTGTTGCTGCATCAGTGACAGCCAAGTCTTCAGTGCAAAGACGGAGCCAGCCACAGCTTACACAAATGTCGGTGCCCCTGGTCCACCAGGTGAAAAAGGCTGCCCCACTGATTGTAGAGGTCTTCAACAAGGTCCTTCACAGCTCCAACCCCGTGCCCCTCTATGCGCCAAATCTCAGCCCGCCTGCGGACAGCAGGATCCACGTGCCGGCCAGTGGGTACTGCTGCCTGGAGTGTGGAGACGCATTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATGGCCGGCGGAGCGTCCACATTGAGGTACTGTGCACACTGTGCTCCAAGACGCTGCTCTTCTTCAACAAGTGCAGCCTGCTCCGGCACGCCCGTGACCACAAGAGCAAGGGGCTCGTCATGCAGTGTTCCCAGCTGCTGGTGAAGCCTATCTCTGCGGACCAAATGTTCGTGTCGGCCCCTGTGAACTCCACGGCACCAGCAGCCCCAGCCCCTTCATCCTCTCCCAAACATGGCCTCACTTCGGGCAGTGCCAGTCCCCCTCCTCCAGCCTTGCCACTCTACCCAGACCCTGTGAGGCTCATCCGGTACTCAATCAAGTGTCTTGAATGTCACAAGCAGATGCGGGACTACATGGTCCTGGCTGCACATTTCCAGAGGACAACAGAGGAGACAGAGGGGCTGACCTGCCAGGTATGCCAGATGCTGCTGCCCAACCAGTGCAGTTTCTGTGCCCACCAGCGGATTCATGCACACAAGTCCCCCTACTGCTGCCCGGAGTGTGGGGTCCTCTGCCGCTCTGCCTACTTCCAGACCCATGTAAAGGAGAATTGCCTGCACTATGCCCGCAAGGTGGGCTACAGGTGCATCCACTGTGGTGTCGTCCACCTGACCTTGGCCTTGCTGAAAAGCCACATCCAGGAGCGACACTGCCAGGTTTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTGCCAGCAGCACTGCAGACCACAGTGCCACCCAGCACCCCACCCAGCCCCACAGACCCTCCCAGCTCATTTATAAGTGCTCCTGTGAAATGGTCTTCAACAAGAAGAGGCACATTCAGCAGCATTTTTACCAGAATGTCAGCAAGACGCAGGTGGGCGTCTTCAAGTGCCCTGAGTGCCCACTCTTGTTCGTGCAGAAGCCGGAGTTGATGCAACACGTCAAGAGCACCCACGGTGTTCCCCGAAATGTGGACGAGCTGTCAAACCTCCAGTCTTCAGCGGACACATCCTCAAGCCGCCCTGGCTCTCGAGTTCCCACTGAGCCACCAGCCACTAGTGTGGCTGCTCGGAGCAGCTCCCTGCCTTCTGGCCGCTGGGGTAGGCCTGAAGCCCACCGCAGGGTGGAAGCCAGGCCGCGGCTGAGGAACACTGGCTGGACCTGCCAGGAGTGCCAGGAGTGGGTTCCAGATCGGGAGAGCTACGTGTCCCACATGAAAAAGAGCCACGGTCGGACATTGAAGCGGTACCCATGCCGGCAGTGTGAACAGTCCTTCCACACCCCCAACAGCCTGCGCAAACACATCCGCAACAACCATGACACAGTAAAGAAGTTCTACACCTGCGGGTACTGCACAGAGGACAGCCCCAGCTTTCCTCGGCCCTCCCTTCTGGAGAGCCACATCAGCCTTATGCATGGCATCAGAAACCCTGATTTGAGCCAGACGTCCAAAGTGAAACCTCCGGGTGGACATTCCCCTCAGGTGAACCATCTGAAAAGACCAGTCAGTGGAGTGGGGGACGCTCCAGGCACCAGCAATGGCGCAACTGTCTCTTCCACCAAAAGGCACAAGTCCCTTTTTCAGTGCGCGAAATGTAGTTTTGCCACAGACTCGGGGCTCGAGTTTCAGAGCCACATACCTCAGCACCAGGTGGACAGCTCCACAGCCCAATGTCTCCTCTGTGGTTTGTGCTACACCTCTGCCAGCTCCCTCAGCCGCCACCTCTTCATTGTCCACAAGGTGAGAGACCAGGAGGAGGAGGAGGAAGAGGAGGCGGCGGCAGCGGAGATGGCAGTGGAGGTGGCAGAGCCAGAGGAGGGCTCCGGGGAGGAGGTGCCCATGGAGACTAGAGAGAATGGACTGGAAGAATGTGCCGGTGAGCCTTTGTCAGCTGACCCAGAGGCGAGGAGATTGCTGGGCCCGGCCCCTGAGGACGATGGTGGCCACAATGATCACAGTCAACCACAGGCCTCTCAGGACCAGGACAGCCACACACTGTCCCCTCAGGTGTGAGCGGCCGC
Amino Acid Sequence: 
MHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI FFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDN HYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSSEFMGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESV SLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDP IKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEALEFNSHPSNSI GESKGLARELGTCSSVPPRQRLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSI CSDSSSKGSPSVAASSPPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSEMPGDEVPVEEHFPEAGTNSGSPQGARKGDESM TKASDSSSPSCSSGPRVPKGAAPGSQTGKKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPLVHQVKKAAPLIV EVFNKVLHSSNPVPLYAPNLSPPADSRIHVPASGYCCLECGDAFALEKSLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLL VKPISADQMFVSAPVNSTAPAAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQMRDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQ CSFCAHQRIHAHKSPYCCPECGVLCRSAYFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTASSTADHSATQHPT QPHRPSQLIYKCSCEMVFNKKRHIQQHFYQNVSKTQVGVFKCPECPLLFVQKPELMQHVKSTHGVPRNVDELSNLQSSADTSSSRPGSRVPTEPPATSVA ARSSSLPSGRWGRPEAHRRVEARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQSFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDS PSFPRPSLLESHISLMHGIRNPDLSQTSKVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQSHIPQHQVDSST AQCLLCGLCYTSASSLSRHLFIVHKVRDQEEEEEEEAAAAEMAVEVAEPEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQP QASQDQDSHTLSPQV*
Price: £125.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

ZNF592

cDNA Synonyms: 
CAMOS; SCAR5
DU Number: 
DU67251
Plasmid: 
pBabeD puro 3FLAG ZNF592
Expressed: 
3FLAG ZNF592
Genbank: 
NM_014630.2 with benign SNP S926N and one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGGGGGATATGAAAACCCCAGATTTTGATGACCTTCTGGCTGCCTTTGACATCCCAGACCCCACCAGCCTTGATGCCAAGGAGGCCATCCAGACACCCAGTGAGGAGAATGAGAGTCCCCTCAAACCTCCAGGCATATGTATGGATGAAAGTGTGTCCTTGTCTCACTCAGGATCAGCCCCCGATGTGCCGGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAGGAGTCATTTGAAGCGGAGAAAGACCACATTACTCCCAGTCTCCTACACAATGGATTCCGGGGCTCAGATCTGCCTCCAGATCCCCACAACTGTGGGAAATTTGATTCTACTTTTATGAATGGAGACAGTGCCAGGAGTTTCCCTGGCAAACTGGAGCCTCCCAAGTCAGAGCCATTACCCACCTTCAACCAGTTCAGTCCAATCTCCAGCCCAGAACCTGAGGATCCCATCAAAGATAACGGATTTGGGATAAAGCCCAAACACTCTGACAGTTATTTCCCACCCCCTCTTGGGTGCGGGGCTGTGGGAGGCCCAGTCCTGGAGGCTCTGGCTAAGTTTCCGGTTCCAGAGCTGCATATGTTTGATCATTTTTGTAAGAAAGAACCCAAGCCAGAACCCCTGCCCTTGGGGAGCCAGCAGGAACACGAGCAAAGTGGGCAGAACACAGTGGAACCTCACAAGGATCCGGATGCCACTCGATTCTTCGGGGAAGCTTTGGAGTTCAACAGCCATCCTAGCAACAGTATTGGAGAGTCCAAGGGGCTTGCCCGGGAGCTTGGTACCTGCTCATCAGTCCCCCCTAGGCAGCGTCTAAAGCCAGCTCATTCCAAGCTGTCCTCTTGTGTGGCAGCCTTGGTGGCCTTGCAGGCCAAAAGAGTGGCTAGTGTCACTAAGGAGGATCAGCCTGGCCACACAAAGGATCTCTCAGGGCCCACTAAAGAGAGTTCTAAAGGTAGCCCCAAAATGCCCAAGTCACCAAAGAGTCCCCGGAGCCCTCTGGAGGCCACTAGAAAAAGTATCAAGCCATCGGACAGCCCTCGTAGCATCTGCAGTGACAGCAGCAGCAAAGGCTCACCGTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTGAGAATCAAAACCATTAAGACATCATCAGGGGAAATCAAACGGACTGTCACAAGGATCCTGCCAGATCCTGATGATCCAAGTAAGTCCCCTGTTGGGTCACCTCTAGGGAGCGCCATTGCAGAGGCCCCCAGCGAGATGCCAGGGGATGAGGTGCCTGTGGAAGAGCACTTTCCTGAGGCAGGCACAAATTCAGGGAGCCCCCAGGGGGCCAGGAAAGGGGACGAGAGCATGACAAAGGCCAGTGACTCGTCATCTCCCAGCTGCAGTTCTGGGCCCCGGGTCCCAAAGGGGGCTGCCCCAGGCTCACAGACAGGCAAGAAGCAACAGAGCACAGCACTGCAGGCATCCACCCTGGCCCCTGCCAACCTCCTGCCCAAAGCCGTGCACTTGGCCAACCTGAACCTCGTCCCCCACAGTGTTGCTGCATCAGTGACAGCCAAGTCTTCAGTGCAAAGACGGAGCCAGCCACAGCTTACACAAATGTCGGTGCCCCTGGTCCACCAGGTGAAAAAGGCTGCCCCACTGATTGTAGAGGTCTTCAACAAGGTCCTTCACAGCTCCAACCCCGTGCCCCTCTATGCGCCAAATCTCAGCCCGCCTGCGGACAGCAGGATCCACGTGCCGGCCAGTGGGTACTGCTGCCTGGAGTGTGGAGACGCATTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATGGCCGGCGGAGCGTCCACATTGAGGTACTGTGCACACTGTGCTCCAAGACGCTGCTCTTCTTCAACAAGTGCAGCCTGCTCCGGCACGCCCGTGACCACAAGAGCAAGGGGCTCGTCATGCAGTGTTCCCAGCTGCTGGTGAAGCCTATCTCTGCGGACCAAATGTTCGTGTCGGCCCCTGTGAACTCCACGGCACCAGCAGCCCCAGCCCCTTCATCCTCTCCCAAACATGGCCTCACTTCGGGCAGTGCCAGTCCCCCTCCTCCAGCCTTGCCACTCTACCCAGACCCTGTGAGGCTCATCCGGTACTCAATCAAGTGTCTTGAATGTCACAAGCAGATGCGGGACTACATGGTCCTGGCTGCACATTTCCAGAGGACAACAGAGGAGACAGAGGGGCTGACCTGCCAGGTATGCCAGATGCTGCTGCCCAACCAGTGCAGTTTCTGTGCCCACCAGCGGATTCATGCACACAAGTCCCCCTACTGCTGCCCGGAGTGTGGGGTCCTCTGCCGCTCTGCCTACTTCCAGACCCATGTAAAGGAGAATTGCCTGCACTATGCCCGCAAGGTGGGCTACAGGTGCATCCACTGTGGTGTCGTCCACCTGACCTTGGCCTTGCTGAAAAGCCACATCCAGGAGCGACACTGCCAGGTTTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTGCCAGCAGCACTGCAGACCACAGTGCCACCCAGCACCCCACCCAGCCCCACAGACCCTCCCAGCTCATTTATAAGTGCTCCTGTGAAATGGTCTTCAACAAGAAGAGGCACATTCAGCAGCATTTTTACCAGAATGTCAGCAAGACGCAGGTGGGCGTCTTCAAGTGCCCTGAGTGCCCACTCTTGTTCGTGCAGAAGCCGGAGTTGATGCAACACGTCAAGAGCACCCACGGTGTTCCCCGAAATGTGGACGAGCTGTCAAACCTCCAGTCTTCAGCGGACACATCCTCAAGCCGCCCTGGCTCTCGAGTTCCCACTGAGCCACCAGCCACTAGTGTGGCTGCTCGGAGCAGCTCCCTGCCTTCTGGCCGCTGGGGTAGGCCTGAAGCCCACCGCAGGGTGGAAGCCAGGCCGCGGCTGAGGAACACTGGCTGGACCTGCCAGGAGTGCCAGGAGTGGGTTCCAGATCGGGAGAGCTACGTGTCCCACATGAAAAAGAGCCACGGTCGGACATTGAAGCGGTACCCATGCCGGCAGTGTGAACAGTCCTTCCACACCCCCAACAGCCTGCGCAAACACATCCGCAACAACCATGACACAGTAAAGAAGTTCTACACCTGCGGGTACTGCACAGAGGACAGCCCCAGCTTTCCTCGGCCCTCCCTTCTGGAGAGCCACATCAGCCTTATGCATGGCATCAGAAACCCTGATTTGAGCCAGACGTCCAAAGTGAAACCTCCGGGTGGACATTCCCCTCAGGTGAACCATCTGAAAAGACCAGTCAGTGGAGTGGGGGACGCTCCAGGCACCAGCAATGGCGCAACTGTCTCTTCCACCAAAAGGCACAAGTCCCTTTTTCAGTGCGCGAAATGTAGTTTTGCCACAGACTCGGGGCTCGAGTTTCAGAGCCACATACCTCAGCACCAGGTGGACAGCTCCACAGCCCAATGTCTCCTCTGTGGTTTGTGCTACACCTCTGCCAGCTCCCTCAGCCGCCACCTCTTCATTGTCCACAAGGTGAGAGACCAGGAGGAGGAGGAGGAAGAGGAGGCGGCGGCAGCGGAGATGGCAGTGGAGGTGGCAGAGCCAGAGGAGGGCTCCGGGGAGGAGGTGCCCATGGAGACTAGAGAGAATGGACTGGAAGAATGTGCCGGTGAGCCTTTGTCAGCTGACCCAGAGGCGAGGAGATTGCTGGGCCCGGCCCCTGAGGACGATGGTGGCCACAATGATCACAGTCAACCACAGGCCTCTCAGGACCAGGACAGCCACACACTGTCCCCTCAGGTGTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSSEFMGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIVKN TSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPP LGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEALEFNSHPSNSIGESKGLARELGTCSSVPPRQ RLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKGSPSVAASSPPAI PKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSEMPGDEVPVEEHFPEAGTNSGSPQGARKGDESMTKASDSSSPSCSSGPRVPKG AAPGSQTGKKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPLVHQVKKAAPLIVEVFNKVLHSSNPVPLYAPNL SPPADSRIHVPASGYCCLECGDAFALEKSLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLLVKPISADQMFVSAPVNSTAP AAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQMRDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQCSFCAHQRIHAHKSPYCCPE CGVLCRSAYFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTASSTADHSATQHPTQPHRPSQLIYKCSCEMVFNK KRHIQQHFYQNVSKTQVGVFKCPECPLLFVQKPELMQHVKSTHGVPRNVDELSNLQSSADTSSSRPGSRVPTEPPATSVAARSSSLPSGRWGRPEAHRRV EARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQSFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDSPSFPRPSLLESHISLMHGIR NPDLSQTSKVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQSHIPQHQVDSSTAQCLLCGLCYTSASSLSRHL FIVHKVRDQEEEEEEEAAAAEMAVEVAEPEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQPQASQDQDSHTLSPQV*
Price: £125.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

ZNF592

cDNA Synonyms: 
CAMOS; SCAR5
DU Number: 
DU67250
Plasmid: 
pcDNA5 FRT/TO 3FLAG ZNF592
Expressed: 
3FLAG ZNF592
Genbank: 
NM_014630.2 with benign SNP S926N and one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGGGGGATATGAAAACCCCAGATTTTGATGACCTTCTGGCTGCCTTTGACATCCCAGACCCCACCAGCCTTGATGCCAAGGAGGCCATCCAGACACCCAGTGAGGAGAATGAGAGTCCCCTCAAACCTCCAGGCATATGTATGGATGAAAGTGTGTCCTTGTCTCACTCAGGATCAGCCCCCGATGTGCCGGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAGGAGTCATTTGAAGCGGAGAAAGACCACATTACTCCCAGTCTCCTACACAATGGATTCCGGGGCTCAGATCTGCCTCCAGATCCCCACAACTGTGGGAAATTTGATTCTACTTTTATGAATGGAGACAGTGCCAGGAGTTTCCCTGGCAAACTGGAGCCTCCCAAGTCAGAGCCATTACCCACCTTCAACCAGTTCAGTCCAATCTCCAGCCCAGAACCTGAGGATCCCATCAAAGATAACGGATTTGGGATAAAGCCCAAACACTCTGACAGTTATTTCCCACCCCCTCTTGGGTGCGGGGCTGTGGGAGGCCCAGTCCTGGAGGCTCTGGCTAAGTTTCCGGTTCCAGAGCTGCATATGTTTGATCATTTTTGTAAGAAAGAACCCAAGCCAGAACCCCTGCCCTTGGGGAGCCAGCAGGAACACGAGCAAAGTGGGCAGAACACAGTGGAACCTCACAAGGATCCGGATGCCACTCGATTCTTCGGGGAAGCTTTGGAGTTCAACAGCCATCCTAGCAACAGTATTGGAGAGTCCAAGGGGCTTGCCCGGGAGCTTGGTACCTGCTCATCAGTCCCCCCTAGGCAGCGTCTAAAGCCAGCTCATTCCAAGCTGTCCTCTTGTGTGGCAGCCTTGGTGGCCTTGCAGGCCAAAAGAGTGGCTAGTGTCACTAAGGAGGATCAGCCTGGCCACACAAAGGATCTCTCAGGGCCCACTAAAGAGAGTTCTAAAGGTAGCCCCAAAATGCCCAAGTCACCAAAGAGTCCCCGGAGCCCTCTGGAGGCCACTAGAAAAAGTATCAAGCCATCGGACAGCCCTCGTAGCATCTGCAGTGACAGCAGCAGCAAAGGCTCACCGTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTGAGAATCAAAACCATTAAGACATCATCAGGGGAAATCAAACGGACTGTCACAAGGATCCTGCCAGATCCTGATGATCCAAGTAAGTCCCCTGTTGGGTCACCTCTAGGGAGCGCCATTGCAGAGGCCCCCAGCGAGATGCCAGGGGATGAGGTGCCTGTGGAAGAGCACTTTCCTGAGGCAGGCACAAATTCAGGGAGCCCCCAGGGGGCCAGGAAAGGGGACGAGAGCATGACAAAGGCCAGTGACTCGTCATCTCCCAGCTGCAGTTCTGGGCCCCGGGTCCCAAAGGGGGCTGCCCCAGGCTCACAGACAGGCAAGAAGCAACAGAGCACAGCACTGCAGGCATCCACCCTGGCCCCTGCCAACCTCCTGCCCAAAGCCGTGCACTTGGCCAACCTGAACCTCGTCCCCCACAGTGTTGCTGCATCAGTGACAGCCAAGTCTTCAGTGCAAAGACGGAGCCAGCCACAGCTTACACAAATGTCGGTGCCCCTGGTCCACCAGGTGAAAAAGGCTGCCCCACTGATTGTAGAGGTCTTCAACAAGGTCCTTCACAGCTCCAACCCCGTGCCCCTCTATGCGCCAAATCTCAGCCCGCCTGCGGACAGCAGGATCCACGTGCCGGCCAGTGGGTACTGCTGCCTGGAGTGTGGAGACGCATTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATGGCCGGCGGAGCGTCCACATTGAGGTACTGTGCACACTGTGCTCCAAGACGCTGCTCTTCTTCAACAAGTGCAGCCTGCTCCGGCACGCCCGTGACCACAAGAGCAAGGGGCTCGTCATGCAGTGTTCCCAGCTGCTGGTGAAGCCTATCTCTGCGGACCAAATGTTCGTGTCGGCCCCTGTGAACTCCACGGCACCAGCAGCCCCAGCCCCTTCATCCTCTCCCAAACATGGCCTCACTTCGGGCAGTGCCAGTCCCCCTCCTCCAGCCTTGCCACTCTACCCAGACCCTGTGAGGCTCATCCGGTACTCAATCAAGTGTCTTGAATGTCACAAGCAGATGCGGGACTACATGGTCCTGGCTGCACATTTCCAGAGGACAACAGAGGAGACAGAGGGGCTGACCTGCCAGGTATGCCAGATGCTGCTGCCCAACCAGTGCAGTTTCTGTGCCCACCAGCGGATTCATGCACACAAGTCCCCCTACTGCTGCCCGGAGTGTGGGGTCCTCTGCCGCTCTGCCTACTTCCAGACCCATGTAAAGGAGAATTGCCTGCACTATGCCCGCAAGGTGGGCTACAGGTGCATCCACTGTGGTGTCGTCCACCTGACCTTGGCCTTGCTGAAAAGCCACATCCAGGAGCGACACTGCCAGGTTTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTGCCAGCAGCACTGCAGACCACAGTGCCACCCAGCACCCCACCCAGCCCCACAGACCCTCCCAGCTCATTTATAAGTGCTCCTGTGAAATGGTCTTCAACAAGAAGAGGCACATTCAGCAGCATTTTTACCAGAATGTCAGCAAGACGCAGGTGGGCGTCTTCAAGTGCCCTGAGTGCCCACTCTTGTTCGTGCAGAAGCCGGAGTTGATGCAACACGTCAAGAGCACCCACGGTGTTCCCCGAAATGTGGACGAGCTGTCAAACCTCCAGTCTTCAGCGGACACATCCTCAAGCCGCCCTGGCTCTCGAGTTCCCACTGAGCCACCAGCCACTAGTGTGGCTGCTCGGAGCAGCTCCCTGCCTTCTGGCCGCTGGGGTAGGCCTGAAGCCCACCGCAGGGTGGAAGCCAGGCCGCGGCTGAGGAACACTGGCTGGACCTGCCAGGAGTGCCAGGAGTGGGTTCCAGATCGGGAGAGCTACGTGTCCCACATGAAAAAGAGCCACGGTCGGACATTGAAGCGGTACCCATGCCGGCAGTGTGAACAGTCCTTCCACACCCCCAACAGCCTGCGCAAACACATCCGCAACAACCATGACACAGTAAAGAAGTTCTACACCTGCGGGTACTGCACAGAGGACAGCCCCAGCTTTCCTCGGCCCTCCCTTCTGGAGAGCCACATCAGCCTTATGCATGGCATCAGAAACCCTGATTTGAGCCAGACGTCCAAAGTGAAACCTCCGGGTGGACATTCCCCTCAGGTGAACCATCTGAAAAGACCAGTCAGTGGAGTGGGGGACGCTCCAGGCACCAGCAATGGCGCAACTGTCTCTTCCACCAAAAGGCACAAGTCCCTTTTTCAGTGCGCGAAATGTAGTTTTGCCACAGACTCGGGGCTCGAGTTTCAGAGCCACATACCTCAGCACCAGGTGGACAGCTCCACAGCCCAATGTCTCCTCTGTGGTTTGTGCTACACCTCTGCCAGCTCCCTCAGCCGCCACCTCTTCATTGTCCACAAGGTGAGAGACCAGGAGGAGGAGGAGGAAGAGGAGGCGGCGGCAGCGGAGATGGCAGTGGAGGTGGCAGAGCCAGAGGAGGGCTCCGGGGAGGAGGTGCCCATGGAGACTAGAGAGAATGGACTGGAAGAATGTGCCGGTGAGCCTTTGTCAGCTGACCCAGAGGCGAGGAGATTGCTGGGCCCGGCCCCTGAGGACGATGGTGGCCACAATGATCACAGTCAACCACAGGCCTCTCAGGACCAGGACAGCCACACACTGTCCCCTCAGGTGTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSPEFMGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSV IVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSY FPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEALEFNSHPSNSIGESKGLARELGTCSSV PPRQRLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKGSPSVAASS PPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSEMPGDEVPVEEHFPEAGTNSGSPQGARKGDESMTKASDSSSPSCSSGPR VPKGAAPGSQTGKKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPLVHQVKKAAPLIVEVFNKVLHSSNPVPLY APNLSPPADSRIHVPASGYCCLECGDAFALEKSLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLLVKPISADQMFVSAPVN STAPAAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQMRDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQCSFCAHQRIHAHKSPY CCPECGVLCRSAYFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTASSTADHSATQHPTQPHRPSQLIYKCSCEM VFNKKRHIQQHFYQNVSKTQVGVFKCPECPLLFVQKPELMQHVKSTHGVPRNVDELSNLQSSADTSSSRPGSRVPTEPPATSVAARSSSLPSGRWGRPEA HRRVEARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQSFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDSPSFPRPSLLESHISLM HGIRNPDLSQTSKVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQSHIPQHQVDSSTAQCLLCGLCYTSASSL SRHLFIVHKVRDQEEEEEEEAAAAEMAVEVAEPEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQPQASQDQDSHTLSPQV*
Price: £125.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

ZNF592

cDNA Synonyms: 
CAMOS; SCAR5
DU Number: 
DU67237
Plasmid: 
pcDNA5D FRT/TO GFP ZNF592
Expressed: 
GFP-ZNF592
Genbank: 
NM_014630.2 with benign SNP S926N and one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGGGGGATATGAAAACCCCAGATTTTGATGACCTTCTGGCTGCCTTTGACATCCCAGACCCCACCAGCCTTGATGCCAAGGAGGCCATCCAGACACCCAGTGAGGAGAATGAGAGTCCCCTCAAACCTCCAGGCATATGTATGGATGAAAGTGTGTCCTTGTCTCACTCAGGATCAGCCCCCGATGTGCCGGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAGGAGTCATTTGAAGCGGAGAAAGACCACATTACTCCCAGTCTCCTACACAATGGATTCCGGGGCTCAGATCTGCCTCCAGATCCCCACAACTGTGGGAAATTTGATTCTACTTTTATGAATGGAGACAGTGCCAGGAGTTTCCCTGGCAAACTGGAGCCTCCCAAGTCAGAGCCATTACCCACCTTCAACCAGTTCAGTCCAATCTCCAGCCCAGAACCTGAGGATCCCATCAAAGATAACGGATTTGGGATAAAGCCCAAACACTCTGACAGTTATTTCCCACCCCCTCTTGGGTGCGGGGCTGTGGGAGGCCCAGTCCTGGAGGCTCTGGCTAAGTTTCCGGTTCCAGAGCTGCATATGTTTGATCATTTTTGTAAGAAAGAACCCAAGCCAGAACCCCTGCCCTTGGGGAGCCAGCAGGAACACGAGCAAAGTGGGCAGAACACAGTGGAACCTCACAAGGATCCGGATGCCACTCGATTCTTCGGGGAAGCTTTGGAGTTCAACAGCCATCCTAGCAACAGTATTGGAGAGTCCAAGGGGCTTGCCCGGGAGCTTGGTACCTGCTCATCAGTCCCCCCTAGGCAGCGTCTAAAGCCAGCTCATTCCAAGCTGTCCTCTTGTGTGGCAGCCTTGGTGGCCTTGCAGGCCAAAAGAGTGGCTAGTGTCACTAAGGAGGATCAGCCTGGCCACACAAAGGATCTCTCAGGGCCCACTAAAGAGAGTTCTAAAGGTAGCCCCAAAATGCCCAAGTCACCAAAGAGTCCCCGGAGCCCTCTGGAGGCCACTAGAAAAAGTATCAAGCCATCGGACAGCCCTCGTAGCATCTGCAGTGACAGCAGCAGCAAAGGCTCACCGTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTGAGAATCAAAACCATTAAGACATCATCAGGGGAAATCAAACGGACTGTCACAAGGATCCTGCCAGATCCTGATGATCCAAGTAAGTCCCCTGTTGGGTCACCTCTAGGGAGCGCCATTGCAGAGGCCCCCAGCGAGATGCCAGGGGATGAGGTGCCTGTGGAAGAGCACTTTCCTGAGGCAGGCACAAATTCAGGGAGCCCCCAGGGGGCCAGGAAAGGGGACGAGAGCATGACAAAGGCCAGTGACTCGTCATCTCCCAGCTGCAGTTCTGGGCCCCGGGTCCCAAAGGGGGCTGCCCCAGGCTCACAGACAGGCAAGAAGCAACAGAGCACAGCACTGCAGGCATCCACCCTGGCCCCTGCCAACCTCCTGCCCAAAGCCGTGCACTTGGCCAACCTGAACCTCGTCCCCCACAGTGTTGCTGCATCAGTGACAGCCAAGTCTTCAGTGCAAAGACGGAGCCAGCCACAGCTTACACAAATGTCGGTGCCCCTGGTCCACCAGGTGAAAAAGGCTGCCCCACTGATTGTAGAGGTCTTCAACAAGGTCCTTCACAGCTCCAACCCCGTGCCCCTCTATGCGCCAAATCTCAGCCCGCCTGCGGACAGCAGGATCCACGTGCCGGCCAGTGGGTACTGCTGCCTGGAGTGTGGAGACGCATTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATGGCCGGCGGAGCGTCCACATTGAGGTACTGTGCACACTGTGCTCCAAGACGCTGCTCTTCTTCAACAAGTGCAGCCTGCTCCGGCACGCCCGTGACCACAAGAGCAAGGGGCTCGTCATGCAGTGTTCCCAGCTGCTGGTGAAGCCTATCTCTGCGGACCAAATGTTCGTGTCGGCCCCTGTGAACTCCACGGCACCAGCAGCCCCAGCCCCTTCATCCTCTCCCAAACATGGCCTCACTTCGGGCAGTGCCAGTCCCCCTCCTCCAGCCTTGCCACTCTACCCAGACCCTGTGAGGCTCATCCGGTACTCAATCAAGTGTCTTGAATGTCACAAGCAGATGCGGGACTACATGGTCCTGGCTGCACATTTCCAGAGGACAACAGAGGAGACAGAGGGGCTGACCTGCCAGGTATGCCAGATGCTGCTGCCCAACCAGTGCAGTTTCTGTGCCCACCAGCGGATTCATGCACACAAGTCCCCCTACTGCTGCCCGGAGTGTGGGGTCCTCTGCCGCTCTGCCTACTTCCAGACCCATGTAAAGGAGAATTGCCTGCACTATGCCCGCAAGGTGGGCTACAGGTGCATCCACTGTGGTGTCGTCCACCTGACCTTGGCCTTGCTGAAAAGCCACATCCAGGAGCGACACTGCCAGGTTTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTGCCAGCAGCACTGCAGACCACAGTGCCACCCAGCACCCCACCCAGCCCCACAGACCCTCCCAGCTCATTTATAAGTGCTCCTGTGAAATGGTCTTCAACAAGAAGAGGCACATTCAGCAGCATTTTTACCAGAATGTCAGCAAGACGCAGGTGGGCGTCTTCAAGTGCCCTGAGTGCCCACTCTTGTTCGTGCAGAAGCCGGAGTTGATGCAACACGTCAAGAGCACCCACGGTGTTCCCCGAAATGTGGACGAGCTGTCAAACCTCCAGTCTTCAGCGGACACATCCTCAAGCCGCCCTGGCTCTCGAGTTCCCACTGAGCCACCAGCCACTAGTGTGGCTGCTCGGAGCAGCTCCCTGCCTTCTGGCCGCTGGGGTAGGCCTGAAGCCCACCGCAGGGTGGAAGCCAGGCCGCGGCTGAGGAACACTGGCTGGACCTGCCAGGAGTGCCAGGAGTGGGTTCCAGATCGGGAGAGCTACGTGTCCCACATGAAAAAGAGCCACGGTCGGACATTGAAGCGGTACCCATGCCGGCAGTGTGAACAGTCCTTCCACACCCCCAACAGCCTGCGCAAACACATCCGCAACAACCATGACACAGTAAAGAAGTTCTACACCTGCGGGTACTGCACAGAGGACAGCCCCAGCTTTCCTCGGCCCTCCCTTCTGGAGAGCCACATCAGCCTTATGCATGGCATCAGAAACCCTGATTTGAGCCAGACGTCCAAAGTGAAACCTCCGGGTGGACATTCCCCTCAGGTGAACCATCTGAAAAGACCAGTCAGTGGAGTGGGGGACGCTCCAGGCACCAGCAATGGCGCAACTGTCTCTTCCACCAAAAGGCACAAGTCCCTTTTTCAGTGCGCGAAATGTAGTTTTGCCACAGACTCGGGGCTCGAGTTTCAGAGCCACATACCTCAGCACCAGGTGGACAGCTCCACAGCCCAATGTCTCCTCTGTGGTTTGTGCTACACCTCTGCCAGCTCCCTCAGCCGCCACCTCTTCATTGTCCACAAGGTGAGAGACCAGGAGGAGGAGGAGGAAGAGGAGGCGGCGGCAGCGGAGATGGCAGTGGAGGTGGCAGAGCCAGAGGAGGGCTCCGGGGAGGAGGTGCCCATGGAGACTAGAGAGAATGGACTGGAAGAATGTGCCGGTGAGCCTTTGTCAGCTGACCCAGAGGCGAGGAGATTGCTGGGCCCGGCCCCTGAGGACGATGGTGGCCACAATGATCACAGTCAACCACAGGCCTCTCAGGACCAGGACAGCCACACACTGTCCCCTCAGGTGTGAGCGGCCGC
Amino Acid Sequence: 
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSPGEFMGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESV SLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDP IKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEALEFNSHPSNSI GESKGLARELGTCSSVPPRQRLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSI CSDSSSKGSPSVAASSPPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSEMPGDEVPVEEHFPEAGTNSGSPQGARKGDESM TKASDSSSPSCSSGPRVPKGAAPGSQTGKKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPLVHQVKKAAPLIV EVFNKVLHSSNPVPLYAPNLSPPADSRIHVPASGYCCLECGDAFALEKSLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLL VKPISADQMFVSAPVNSTAPAAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQMRDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQ CSFCAHQRIHAHKSPYCCPECGVLCRSAYFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTASSTADHSATQHPT QPHRPSQLIYKCSCEMVFNKKRHIQQHFYQNVSKTQVGVFKCPECPLLFVQKPELMQHVKSTHGVPRNVDELSNLQSSADTSSSRPGSRVPTEPPATSVA ARSSSLPSGRWGRPEAHRRVEARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQSFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDS PSFPRPSLLESHISLMHGIRNPDLSQTSKVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQSHIPQHQVDSST AQCLLCGLCYTSASSLSRHLFIVHKVRDQEEEEEEEAAAAEMAVEVAEPEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQP QASQDQDSHTLSPQV*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
PMID: 
rouse-CDKL5-paper-3

Zscan4c (mouse)

cDNA Synonyms: 
Gm397; XM_142517; Zscan4d
DU Number: 
DU61125
Plasmid: 
pCAGGSD puro mouse Zscan4C HA
Expressed: 
Zscan4c HA (mouse)
Genbank: 
NM_001013765.2
Species: 
Mouse
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTTCACAGCAGGCACCAGCAAAAGACCTTCAGACCAACAATTTAGAGTTTACTCCAACTGATAGTTCTGGTGTGCAGTGGGCAGAAGACATCTCTAACTCACCAAGTGCTCAGCTAAACTTTTCCCCAAGTAACAATGGCTGCTGGGCAACTCAGGAGCTGCAAAGTCTCTGGAAGATGTTCAACTCCTGGTTGCAGCCAGAAAAGCAGACTAAGGAGCAGATGATTTCTCAACTGGTCTTGGAGCAGTTTCTCCTCACTGGGCACTGCAAGGACAAGTATGCTTTGACAGAGAAGTGGAAAGCCAGTGGTAGCGATATGAGGAGATTCATGGAGAGTCTGACTGATGAGTGCTTGAAGCCTCCTGTCATGGTCCATGTTTCAATGCAAGGACAAGAAGCCCTCTTTTCTGAAAACATGCCATTAAAAGAAGTCATCAAGCTTTTGAAACAACAGCAATCTGCAACAAGGCCAACACCAGATAATGAGCAGATGCCAGTAGACACCACACAAGATAGATTATTGGCCACAGGACAAGAAAACAGTGAAAATGAATGCAACAACTCTTGTAATGCTACTGAAGCAAATGTTGGTGAAAGCTGTAGTGGAAATGAAATGGACTCCCTTCTTATTATCCAGAAAGAACAGCACCCTGAGCATGAAGAGGGGAATGTTGTTTGTCAATTCCCTCATGGTGCCAGAAGAGCAAGTCAAGGCACCCCCAGTCATCATGTAGACTTCCCGAGTGCTCCGACTACTGCCGATGTCCCCATGGAGGAACAACCAAAGGATTTATCCAGAGAAAACATCTCTGAGGACAAGAACAATTGCTATAACACTTCCAGAAATGCAGCTACTCAAGTATATAGTGGTGATAATATTCCCAGGAACAAGTCAGACTCCCTTTTCATTAACAAGAGAATATATCATCCTGAGCCTGAGGTGGGAGATATTCCTTATGGAGTTCCTCAGGATTCTACAAGAGCAAGTCAAGGAACATCTACATGCCTGCAAGAGTCACTTGGGGAATGTTTTTCTGAAAACGACCCAAGGGAGGTACCAGGGTTGCAGTCTAGGCAAGAGCAGCCTATCTCTGATCCTGTCCTTCTTGGTAAGAATCATGAGGCAAACTTACCATGTGAAAGTCATCAAAAGAGATTCTGTAGAGATGCCAAACTATACAAGTGTGAAGAATGTTCTAGGATGTTCAAACATGCCAGGAGCCTTTCATCCCACCAGAGAACTCACCTGAATAAGAAGAGTGAATTGCTTTGTGTCACCTGTCAGAAAATGTTCAAACGAGTCTCTGACCGCCGCACCCATGAGATCATACACATGCCAGAAAAGCCTTTCAAGTGCAGCACATGTGAAAAGTCCTTCAGCCACAAGACCAACCTGAAGTCTCATGAGATGATTCACACAGGAGAAATGCCTTATGTCTGTTCCCTATGTAGCCGTCGCTTTCGCCAATCATCCACTTACCATCGTCACCTGAGGAATTACCACAGATCTGACTACCCATACGATGTGCCAGATTACGCCTGAGCGGCCGC
Amino Acid Sequence: 
MASQQAPAKDLQTNNLEFTPTDSSGVQWAEDISNSPSAQLNFSPSNNGCWATQELQSLWKMFNSWLQPEKQTKEQMISQLVLEQFLLTGHCKDKYALTEK WKASGSDMRRFMESLTDECLKPPVMVHVSMQGQEALFSENMPLKEVIKLLKQQQSATRPTPDNEQMPVDTTQDRLLATGQENSENECNNSCNATEANVGE SCSGNEMDSLLIIQKEQHPEHEEGNVVCQFPHGARRASQGTPSHHVDFPSAPTTADVPMEEQPKDLSRENISEDKNNCYNTSRNAATQVYSGDNIPRNKS DSLFINKRIYHPEPEVGDIPYGVPQDSTRASQGTSTCLQESLGECFSENDPREVPGLQSRQEQPISDPVLLGKNHEANLPCESHQKRFCRDAKLYKCEEC SRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLR NYHRSDYPYDVPDYA*
Price: £125.00
Completion Time: 
72
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
355.050758.D101
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Zscan4c (mouse)

cDNA Synonyms: 
Gm397; XM_142517; Zscan4d
DU Number: 
DU61124
Plasmid: 
pCAGGSD puro mouse Zscan4C
Expressed: 
Zscan4c (mouse)
Genbank: 
NM_001013765.2
Species: 
Mouse
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTTCACAGCAGGCACCAGCAAAAGACCTTCAGACCAACAATTTAGAGTTTACTCCAACTGATAGTTCTGGTGTGCAGTGGGCAGAAGACATCTCTAACTCACCAAGTGCTCAGCTAAACTTTTCCCCAAGTAACAATGGCTGCTGGGCAACTCAGGAGCTGCAAAGTCTCTGGAAGATGTTCAACTCCTGGTTGCAGCCAGAAAAGCAGACTAAGGAGCAGATGATTTCTCAACTGGTCTTGGAGCAGTTTCTCCTCACTGGGCACTGCAAGGACAAGTATGCTTTGACAGAGAAGTGGAAAGCCAGTGGTAGCGATATGAGGAGATTCATGGAGAGTCTGACTGATGAGTGCTTGAAGCCTCCTGTCATGGTCCATGTTTCAATGCAAGGACAAGAAGCCCTCTTTTCTGAAAACATGCCATTAAAAGAAGTCATCAAGCTTTTGAAACAACAGCAATCTGCAACAAGGCCAACACCAGATAATGAGCAGATGCCAGTAGACACCACACAAGATAGATTATTGGCCACAGGACAAGAAAACAGTGAAAATGAATGCAACAACTCTTGTAATGCTACTGAAGCAAATGTTGGTGAAAGCTGTAGTGGAAATGAAATGGACTCCCTTCTTATTATCCAGAAAGAACAGCACCCTGAGCATGAAGAGGGGAATGTTGTTTGTCAATTCCCTCATGGTGCCAGAAGAGCAAGTCAAGGCACCCCCAGTCATCATGTAGACTTCCCGAGTGCTCCGACTACTGCCGATGTCCCCATGGAGGAACAACCAAAGGATTTATCCAGAGAAAACATCTCTGAGGACAAGAACAATTGCTATAACACTTCCAGAAATGCAGCTACTCAAGTATATAGTGGTGATAATATTCCCAGGAACAAGTCAGACTCCCTTTTCATTAACAAGAGAATATATCATCCTGAGCCTGAGGTGGGAGATATTCCTTATGGAGTTCCTCAGGATTCTACAAGAGCAAGTCAAGGAACATCTACATGCCTGCAAGAGTCACTTGGGGAATGTTTTTCTGAAAACGACCCAAGGGAGGTACCAGGGTTGCAGTCTAGGCAAGAGCAGCCTATCTCTGATCCTGTCCTTCTTGGTAAGAATCATGAGGCAAACTTACCATGTGAAAGTCATCAAAAGAGATTCTGTAGAGATGCCAAACTATACAAGTGTGAAGAATGTTCTAGGATGTTCAAACATGCCAGGAGCCTTTCATCCCACCAGAGAACTCACCTGAATAAGAAGAGTGAATTGCTTTGTGTCACCTGTCAGAAAATGTTCAAACGAGTCTCTGACCGCCGCACCCATGAGATCATACACATGCCAGAAAAGCCTTTCAAGTGCAGCACATGTGAAAAGTCCTTCAGCCACAAGACCAACCTGAAGTCTCATGAGATGATTCACACAGGAGAAATGCCTTATGTCTGTTCCCTATGTAGCCGTCGCTTTCGCCAATCATCCACTTACCATCGTCACCTGAGGAATTACCACAGATCTGACTGAGCGGCCGC
Amino Acid Sequence: 
MASQQAPAKDLQTNNLEFTPTDSSGVQWAEDISNSPSAQLNFSPSNNGCWATQELQSLWKMFNSWLQPEKQTKEQMISQLVLEQFLLTGHCKDKYALTEK WKASGSDMRRFMESLTDECLKPPVMVHVSMQGQEALFSENMPLKEVIKLLKQQQSATRPTPDNEQMPVDTTQDRLLATGQENSENECNNSCNATEANVGE SCSGNEMDSLLIIQKEQHPEHEEGNVVCQFPHGARRASQGTPSHHVDFPSAPTTADVPMEEQPKDLSRENISEDKNNCYNTSRNAATQVYSGDNIPRNKS DSLFINKRIYHPEPEVGDIPYGVPQDSTRASQGTSTCLQESLGECFSENDPREVPGLQSRQEQPISDPVLLGKNHEANLPCESHQKRFCRDAKLYKCEEC SRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLR NYHRSD*
Price: £125.00
Completion Time: 
72
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
355.050758.D101
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Zscan4c (mouse)

cDNA Synonyms: 
Gm397; Zscan4d; XM_142517
DU Number: 
DU61123
Plasmid: 
pCAGGS puro HA Zscan4c (mouse)
Expressed: 
HA Zscan4c (mouse)
Genbank: 
NM_001013765.2
Species: 
Mouse
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTTCACAGCAGGCACCAGCAAAAGACCTTCAGACCAACAATTTAGAGTTTACTCCAACTGATAGTTCTGGTGTGCAGTGGGCAGAAGACATCTCTAACTCACCAAGTGCTCAGCTAAACTTTTCCCCAAGTAACAATGGCTGCTGGGCAACTCAGGAGCTGCAAAGTCTCTGGAAGATGTTCAACTCCTGGTTGCAGCCAGAAAAGCAGACTAAGGAGCAGATGATTTCTCAACTGGTCTTGGAGCAGTTTCTCCTCACTGGGCACTGCAAGGACAAGTATGCTTTGACAGAGAAGTGGAAAGCCAGTGGTAGCGATATGAGGAGATTCATGGAGAGTCTGACTGATGAGTGCTTGAAGCCTCCTGTCATGGTCCATGTTTCAATGCAAGGACAAGAAGCCCTCTTTTCTGAAAACATGCCATTAAAAGAAGTCATCAAGCTTTTGAAACAACAGCAATCTGCAACAAGGCCAACACCAGATAATGAGCAGATGCCAGTAGACACCACACAAGATAGATTATTGGCCACAGGACAAGAAAACAGTGAAAATGAATGCAACAACTCTTGTAATGCTACTGAAGCAAATGTTGGTGAAAGCTGTAGTGGAAATGAAATGGACTCCCTTCTTATTATCCAGAAAGAACAGCACCCTGAGCATGAAGAGGGGAATGTTGTTTGTCAATTCCCTCATGGTGCCAGAAGAGCAAGTCAAGGCACCCCCAGTCATCATGTAGACTTCCCGAGTGCTCCGACTACTGCCGATGTCCCCATGGAGGAACAACCAAAGGATTTATCCAGAGAAAACATCTCTGAGGACAAGAACAATTGCTATAACACTTCCAGAAATGCAGCTACTCAAGTATATAGTGGTGATAATATTCCCAGGAACAAGTCAGACTCCCTTTTCATTAACAAGAGAATATATCATCCTGAGCCTGAGGTGGGAGATATTCCTTATGGAGTTCCTCAGGATTCTACAAGAGCAAGTCAAGGAACATCTACATGCCTGCAAGAGTCACTTGGGGAATGTTTTTCTGAAAACGACCCAAGGGAGGTACCAGGGTTGCAGTCTAGGCAAGAGCAGCCTATCTCTGATCCTGTCCTTCTTGGTAAGAATCATGAGGCAAACTTACCATGTGAAAGTCATCAAAAGAGATTCTGTAGAGATGCCAAACTATACAAGTGTGAAGAATGTTCTAGGATGTTCAAACATGCCAGGAGCCTTTCATCCCACCAGAGAACTCACCTGAATAAGAAGAGTGAATTGCTTTGTGTCACCTGTCAGAAAATGTTCAAACGAGTCTCTGACCGCCGCACCCATGAGATCATACACATGCCAGAAAAGCCTTTCAAGTGCAGCACATGTGAAAAGTCCTTCAGCCACAAGACCAACCTGAAGTCTCATGAGATGATTCACACAGGAGAAATGCCTTATGTCTGTTCCCTATGTAGCCGTCGCTTTCGCCAATCATCCACTTACCATCGTCACCTGAGGAATTACCACAGATCTGACTGAGCGGCCGC
Amino Acid Sequence: 
MYPYDVPDYAGSMASQQAPAKDLQTNNLEFTPTDSSGVQWAEDISNSPSAQLNFSPSNNGCWATQELQSLWKMFNSWLQPEKQTKEQMISQLVLEQFLLT GHCKDKYALTEKWKASGSDMRRFMESLTDECLKPPVMVHVSMQGQEALFSENMPLKEVIKLLKQQQSATRPTPDNEQMPVDTTQDRLLATGQENSENECN NSCNATEANVGESCSGNEMDSLLIIQKEQHPEHEEGNVVCQFPHGARRASQGTPSHHVDFPSAPTTADVPMEEQPKDLSRENISEDKNNCYNTSRNAATQ VYSGDNIPRNKSDSLFINKRIYHPEPEVGDIPYGVPQDSTRASQGTSTCLQESLGECFSENDPREVPGLQSRQEQPISDPVLLGKNHEANLPCESHQKRF CRDAKLYKCEECSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRR FRQSSTYHRHLRNYHRSD*
Price: £125.00
Completion Time: 
69
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
355.050758.D101
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

ZNF516

cDNA Synonyms: 
HsT287
DU Number: 
DU64018
Plasmid: 
pcDNA5D frtTO GFP ZNF516
Expressed: 
GFP-ZNF516
Genbank: 
NM_014643
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGACCGGAACAGAGAAGCCGAGATGGAACTGAGAAGAGGCCCATCTCCTACCAGAGCCGGAAGAGGCCATGAAGTGGACGGCGATAAGGCCACCTGTCACACCTGTTGTATCTGCGGCAAGAGCTTCCCGTTCCAGTCCAGCCTGAGCCAGCACATGAGAAAGCACACCGGCGAGAAGCCCTACAAGTGCCCCTACTGCGATCACAGAGCCAGCCAGAAGGGCAACCTGAAGATCCACATCAGAAGCCACCGGACCGGCACACTGATTCAGGGACATGAACCTGAGGCCGGCGAAGCCCCTCTGGGAGAAATGAGAGCTAGCGAAGGCCTGGATGCCTGCGCTAGCCCAACAAAATCTGCCAGCGCCTGCAACAGACTGCTGAATGGCGCTTCTCAGGCCGATGGCGCCAGAGTTCTTAATGGCGCTAGCCAGGCCGACAGCGGAAGAGTGCTGCTGAGAAGCTCTAAGAAGGGCGCCGAGGGATCTGCTTGTGCTCCTGGCGAAGCTAAAGCCGCCGTGCAGTGTAGCTTCTGCAAGAGCCAGTTCGAGCGGAAGAAGGACCTGGAACTGCACGTCCACCAGGCTCACAAGCCTTTCAAGTGCCGGCTGTGCAGCTACGCCACACTGAGAGAGGAAAGCCTGCTGAGCCACATCGAGCGGGATCACATCACAGCTCAAGGCCCTGGAAGCGGCGAGGCCTGTGTGGAAAATGGCAAGCCTGAACTGAGCCCTGGCGAGTTCCCTTGTGAAGTGTGCGGCCAGGCCTTTAGCCAGACCTGGTTTCTGAAGGCCCACATGAAGAAGCACCGGGGCAGCTTCGATCACGGCTGCCATATCTGTGGCAGACGGTTCAAAGAGCCATGGTTCCTGAAGAATCACATGAAGGCTCACGGCCCCAAGACCGGCAGCAAGAACAGACCTAAGAGCGAGCTGGACCCTATCGCCACCATCAACAACGTGGTGCAAGAGGAAGTGATCGTTGCCGGCCTGAGCCTGTACGAAGTCTGTGCCAAGTGCGGCAACCTGTTCACCAACCTGGACAGCCTGAACGCCCACAACGCCATCCACAGAAGAGTGGAAGCCAGCAGAACACGGGCCCCTGCTGAAGAAGGTGCCGAAGGACCTAGCGATACCAAGCAGTTCTTCCTGCAGTGCCTGAACCTGCGGCCTTCTGCTGCTGGCGATTCTTGTCCTGGAACACAGGCCGGAAGAAGAGTCGCCGAACTGGACCCCGTGAATAGCTATCAGGCTTGGCAGCTGGCCACCAGAGGCAAAGTTGCCGAGCCTGCCGAGTACCTGAAATACGGCGCTTGGGATGAAGCCCTGGCCGGCGACGTTGCCTTCGATAAGGATCGGAGAGAATACGTGCTGGTGTCCCAAGAGAAGCGCAAGAGAGAACAGGACGCTCCTGCTGCTCAGGGCCCTCCTAGAAAAAGAGCTTCTGGCCCAGGCGATCCTGCTCCTGCCGGACATCTTGATCCTAGATCTGCCGCCAGACCTAACAGAAGGGCCGCTGCTACAACAGGCCAGGGCAAGAGCAGCGAGTGCTTCGAGTGTGGCAAGATCTTCCGGACCTACCACCAGATGGTGCTGCACTCCAGAGTGCACCGCAGAGCCAGACGGGAAAGAGATTCTGACGGCGACAGAGCCGCTAGGGCCAGATGTGGTTCTCTGAGCGAAGGCGATAGCGCCAGCCAGCCTTCTTCTCCTGGTTCTGCATGTGCCGCCGCTGATAGCCCTGGATCTGGACTGGCTGATGAAGCCGCCGAGGATTCTGGCGAAGAAGGCGCTCCTGAACCAGCTCCAGGTGGACAGCCCAGAAGATGCTGCTTCAGCGAAGAAGTGACCAGCACCGAGCTGAGCAGCGGCGATCAGTCTCACAAGATGGGCGACAACGCCAGCGAGAGAGATACCGGCGAGTCTAAGGCCGGAATCGCCGCCTCTGTGTCCATCCTGGAAAACAGCAGCCGGGAAACCAGCCGCCGACAAGAACAGCACAGATTCAGCATGGATCTGAAGATGCCCGCCTTCCATCCTAAGCAAGAGGTGCCAGTTCCTGGCGACGGCGTGGAATTTCCAAGCTCTACAGGCGCCGAAGGCCAGACAGGACACCCTGCCGAAAAGCTGAGCGACCTGCACAACAAAGAGCACAGCGGCGGAGGCAAGAGAGCACTGGCTCCAGATCTGATGCCTCTGGACCTGAGCGCCAGAAGCACTAGGGACGACCCCAGCAACAAAGAAACAGCCAGCTCTCTGCAGGCCGCTCTGGTGGTTCACCCTTGTCCTTACTGCAGCCACAAGACCTACTATCCCGAGGTGCTGTGGATGCACAAGCGGATCTGGCACAGAGTGTCCTGCAATAGCGTGGCCCCTCCATGGATTCAGCCCAACGGCTACAAGAGCATCCGGTCCAACCTGGTGTTCCTGAGCAGAAGCGGAAGGACAGGACCACCTCCTGCTCTCGGCGGAAAAGAGTGTCAACCTCTGCTGCTCGCCCGGTTCACCAGAACACAAGTTCCAGGCGGCATGCCCGGCTCTAAGAGCGGATCTTCTCCACTGGGCGTCGTGACAAAGGCCGCCAGCATGCCCAAGAACAAAGAGAGCCATTCTGGCGGCCCTTGCGCTCTTTGGGCTCCTGGACCAGATGGCTACAGACAGACCAAGCCTTGCCACGGCCAAGAACCTCATGGCGCTGCAACACAAGGCCCTCTGGCCAAGCCTAGACAAGAGGCCAGCTCTAAGCCAGTGCCTGCTCCAGGCGGAGGCGGCTTTTCAAGAAGCGCTACCCCTACACCTACCGTGATCGCTAGAGCAGGCGCACAGCCTAGCGCCAATAGCAAGCCCGTGGAAAAGTTCGGAGTGCCTCCTGCTGGCGCCGGATTTGCCCCTACAAACAAACACAGCGCCCCAGATAGCCTGAAGGCCAAGTTTTCTGCCCAGCCACAGGGTCCTCCACCAGCTAAAGGCGAAGGCGGAGCACCTCCACTGCCTCCAAGAGAGCCTCCATCTAAGGCTGCCCAAGAGCTGAGAACCCTGGCCACATGTGCTGCCGGATCTAGAGGGGATGCTGCCCTGCAAGCTCAACCTGGCGTTGCAGGGGCTCCTCCTGTGCTGCATAGCATCAAGCAAGAGCCTGTGGCCGAGGGCCACGAGAAGAGACTGGATATCCTGAACATCTTCAAGACTTACATCCCCAAGGACTTCGCCACTCTGTACCAAGGCTGGGGAGTGTCTGGACCCGGCCTGGAACATAGAGGCACCCTGAGAACTCAGGCCAGACCAGGCGAGTTCGTGTGTATCGAGTGCGGAAAGTCCTTTCACCAGCCTGGCCATCTGAGAGCCCATATGAGAGCACACAGCGTGGTGTTCGAGAGCGACGGCCCTAGAGGTTCTGAGGTGCACACCACAAGCGCCGACGCTCCTAAGCAGGGCAGAGATCACAGCAATACCGGCACCGTGCAGACCGTGCCTCTGAGAAAGGGAACCTGAGCGGCCGC
Amino Acid Sequence: 
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMDRNREAEMELRRGPSPTRAGRGHEVDGDKATCHTCCICGKSFPFQSSLSQHMRKH TGEKPYKCPYCDHRASQKGNLKIHIRSHRTGTLIQGHEPEAGEAPLGEMRASEGLDACASPTKSASACNRLLNGASQADGARVLNGASQADSGRVLLRSS KKGAEGSACAPGEAKAAVQCSFCKSQFERKKDLELHVHQAHKPFKCRLCSYATLREESLLSHIERDHITAQGPGSGEACVENGKPELSPGEFPCEVCGQA FSQTWFLKAHMKKHRGSFDHGCHICGRRFKEPWFLKNHMKAHGPKTGSKNRPKSELDPIATINNVVQEEVIVAGLSLYEVCAKCGNLFTNLDSLNAHNAI HRRVEASRTRAPAEEGAEGPSDTKQFFLQCLNLRPSAAGDSCPGTQAGRRVAELDPVNSYQAWQLATRGKVAEPAEYLKYGAWDEALAGDVAFDKDRREY VLVSQEKRKREQDAPAAQGPPRKRASGPGDPAPAGHLDPRSAARPNRRAAATTGQGKSSECFECGKIFRTYHQMVLHSRVHRRARRERDSDGDRAARARC GSLSEGDSASQPSSPGSACAAADSPGSGLADEAAEDSGEEGAPEPAPGGQPRRCCFSEEVTSTELSSGDQSHKMGDNASERDTGESKAGIAASVSILENS SRETSRRQEQHRFSMDLKMPAFHPKQEVPVPGDGVEFPSSTGAEGQTGHPAEKLSDLHNKEHSGGGKRALAPDLMPLDLSARSTRDDPSNKETASSLQAA LVVHPCPYCSHKTYYPEVLWMHKRIWHRVSCNSVAPPWIQPNGYKSIRSNLVFLSRSGRTGPPPALGGKECQPLLLARFTRTQVPGGMPGSKSGSSPLGV VTKAASMPKNKESHSGGPCALWAPGPDGYRQTKPCHGQEPHGAATQGPLAKPRQEASSKPVPAPGGGGFSRSATPTPTVIARAGAQPSANSKPVEKFGVP PAGAGFAPTNKHSAPDSLKAKFSAQPQGPPPAKGEGGAPPLPPREPPSKAAQELRTLATCAAGSRGDAALQAQPGVAGAPPVLHSIKQEPVAEGHEKRLD ILNIFKTYIPKDFATLYQGWGVSGPGLEHRGTLRTQARPGEFVCIECGKSFHQPGHLRAHMRAHSVVFESDGPRGSEVHTTSADAPKQGRDHSNTGTVQT VPLRKGT*
Price: £125.00
Completion Time: 
52
Wild-type or Mutant: 
New Protein: 
Yes
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

ZNF516

cDNA Synonyms: 
HsT287
DU Number: 
DU60977
Plasmid: 
pMK-RQ ZNF516 optimised Bam Not
Genbank: 
NM_014643
Species: 
Human
Vector Type: 
Other
Sequence of Insert: 
GGATCCATGGACCGGAACAGAGAAGCCGAGATGGAACTGAGAAGAGGCCCATCTCCTACCAGAGCCGGAAGAGGCCATGAAGTGGACGGCGATAAGGCCACCTGTCACACCTGTTGTATCTGCGGCAAGAGCTTCCCGTTCCAGTCCAGCCTGAGCCAGCACATGAGAAAGCACACCGGCGAGAAGCCCTACAAGTGCCCCTACTGCGATCACAGAGCCAGCCAGAAGGGCAACCTGAAGATCCACATCAGAAGCCACCGGACCGGCACACTGATTCAGGGACATGAACCTGAGGCCGGCGAAGCCCCTCTGGGAGAAATGAGAGCTAGCGAAGGCCTGGATGCCTGCGCTAGCCCAACAAAATCTGCCAGCGCCTGCAACAGACTGCTGAATGGCGCTTCTCAGGCCGATGGCGCCAGAGTTCTTAATGGCGCTAGCCAGGCCGACAGCGGAAGAGTGCTGCTGAGAAGCTCTAAGAAGGGCGCCGAGGGATCTGCTTGTGCTCCTGGCGAAGCTAAAGCCGCCGTGCAGTGTAGCTTCTGCAAGAGCCAGTTCGAGCGGAAGAAGGACCTGGAACTGCACGTCCACCAGGCTCACAAGCCTTTCAAGTGCCGGCTGTGCAGCTACGCCACACTGAGAGAGGAAAGCCTGCTGAGCCACATCGAGCGGGATCACATCACAGCTCAAGGCCCTGGAAGCGGCGAGGCCTGTGTGGAAAATGGCAAGCCTGAACTGAGCCCTGGCGAGTTCCCTTGTGAAGTGTGCGGCCAGGCCTTTAGCCAGACCTGGTTTCTGAAGGCCCACATGAAGAAGCACCGGGGCAGCTTCGATCACGGCTGCCATATCTGTGGCAGACGGTTCAAAGAGCCATGGTTCCTGAAGAATCACATGAAGGCTCACGGCCCCAAGACCGGCAGCAAGAACAGACCTAAGAGCGAGCTGGACCCTATCGCCACCATCAACAACGTGGTGCAAGAGGAAGTGATCGTTGCCGGCCTGAGCCTGTACGAAGTCTGTGCCAAGTGCGGCAACCTGTTCACCAACCTGGACAGCCTGAACGCCCACAACGCCATCCACAGAAGAGTGGAAGCCAGCAGAACACGGGCCCCTGCTGAAGAAGGTGCCGAAGGACCTAGCGATACCAAGCAGTTCTTCCTGCAGTGCCTGAACCTGCGGCCTTCTGCTGCTGGCGATTCTTGTCCTGGAACACAGGCCGGAAGAAGAGTCGCCGAACTGGACCCCGTGAATAGCTATCAGGCTTGGCAGCTGGCCACCAGAGGCAAAGTTGCCGAGCCTGCCGAGTACCTGAAATACGGCGCTTGGGATGAAGCCCTGGCCGGCGACGTTGCCTTCGATAAGGATCGGAGAGAATACGTGCTGGTGTCCCAAGAGAAGCGCAAGAGAGAACAGGACGCTCCTGCTGCTCAGGGCCCTCCTAGAAAAAGAGCTTCTGGCCCAGGCGATCCTGCTCCTGCCGGACATCTTGATCCTAGATCTGCCGCCAGACCTAACAGAAGGGCCGCTGCTACAACAGGCCAGGGCAAGAGCAGCGAGTGCTTCGAGTGTGGCAAGATCTTCCGGACCTACCACCAGATGGTGCTGCACTCCAGAGTGCACCGCAGAGCCAGACGGGAAAGAGATTCTGACGGCGACAGAGCCGCTAGGGCCAGATGTGGTTCTCTGAGCGAAGGCGATAGCGCCAGCCAGCCTTCTTCTCCTGGTTCTGCATGTGCCGCCGCTGATAGCCCTGGATCTGGACTGGCTGATGAAGCCGCCGAGGATTCTGGCGAAGAAGGCGCTCCTGAACCAGCTCCAGGTGGACAGCCCAGAAGATGCTGCTTCAGCGAAGAAGTGACCAGCACCGAGCTGAGCAGCGGCGATCAGTCTCACAAGATGGGCGACAACGCCAGCGAGAGAGATACCGGCGAGTCTAAGGCCGGAATCGCCGCCTCTGTGTCCATCCTGGAAAACAGCAGCCGGGAAACCAGCCGCCGACAAGAACAGCACAGATTCAGCATGGATCTGAAGATGCCCGCCTTCCATCCTAAGCAAGAGGTGCCAGTTCCTGGCGACGGCGTGGAATTTCCAAGCTCTACAGGCGCCGAAGGCCAGACAGGACACCCTGCCGAAAAGCTGAGCGACCTGCACAACAAAGAGCACAGCGGCGGAGGCAAGAGAGCACTGGCTCCAGATCTGATGCCTCTGGACCTGAGCGCCAGAAGCACTAGGGACGACCCCAGCAACAAAGAAACAGCCAGCTCTCTGCAGGCCGCTCTGGTGGTTCACCCTTGTCCTTACTGCAGCCACAAGACCTACTATCCCGAGGTGCTGTGGATGCACAAGCGGATCTGGCACAGAGTGTCCTGCAATAGCGTGGCCCCTCCATGGATTCAGCCCAACGGCTACAAGAGCATCCGGTCCAACCTGGTGTTCCTGAGCAGAAGCGGAAGGACAGGACCACCTCCTGCTCTCGGCGGAAAAGAGTGTCAACCTCTGCTGCTCGCCCGGTTCACCAGAACACAAGTTCCAGGCGGCATGCCCGGCTCTAAGAGCGGATCTTCTCCACTGGGCGTCGTGACAAAGGCCGCCAGCATGCCCAAGAACAAAGAGAGCCATTCTGGCGGCCCTTGCGCTCTTTGGGCTCCTGGACCAGATGGCTACAGACAGACCAAGCCTTGCCACGGCCAAGAACCTCATGGCGCTGCAACACAAGGCCCTCTGGCCAAGCCTAGACAAGAGGCCAGCTCTAAGCCAGTGCCTGCTCCAGGCGGAGGCGGCTTTTCAAGAAGCGCTACCCCTACACCTACCGTGATCGCTAGAGCAGGCGCACAGCCTAGCGCCAATAGCAAGCCCGTGGAAAAGTTCGGAGTGCCTCCTGCTGGCGCCGGATTTGCCCCTACAAACAAACACAGCGCCCCAGATAGCCTGAAGGCCAAGTTTTCTGCCCAGCCACAGGGTCCTCCACCAGCTAAAGGCGAAGGCGGAGCACCTCCACTGCCTCCAAGAGAGCCTCCATCTAAGGCTGCCCAAGAGCTGAGAACCCTGGCCACATGTGCTGCCGGATCTAGAGGGGATGCTGCCCTGCAAGCTCAACCTGGCGTTGCAGGGGCTCCTCCTGTGCTGCATAGCATCAAGCAAGAGCCTGTGGCCGAGGGCCACGAGAAGAGACTGGATATCCTGAACATCTTCAAGACTTACATCCCCAAGGACTTCGCCACTCTGTACCAAGGCTGGGGAGTGTCTGGACCCGGCCTGGAACATAGAGGCACCCTGAGAACTCAGGCCAGACCAGGCGAGTTCGTGTGTATCGAGTGCGGAAAGTCCTTTCACCAGCCTGGCCATCTGAGAGCCCATATGAGAGCACACAGCGTGGTGTTCGAGAGCGACGGCCCTAGAGGTTCTGAGGTGCACACCACAAGCGCCGACGCTCCTAAGCAGGGCAGAGATCACAGCAATACCGGCACCGTGCAGACCGTGCCTCTGAGAAAGGGAACCTGAGCGGCCGC
Amino Acid Sequence: 
MDRNREAEMELRRGPSPTRAGRGHEVDGDKATCHTCCICGKSFPFQSSLSQHMRKHTGEKPYKCPYCDHRASQKGNLKIHIRSHRTGTLIQGHEPEAGEA PLGEMRASEGLDACASPTKSASACNRLLNGASQADGARVLNGASQADSGRVLLRSSKKGAEGSACAPGEAKAAVQCSFCKSQFERKKDLELHVHQAHKPF KCRLCSYATLREESLLSHIERDHITAQGPGSGEACVENGKPELSPGEFPCEVCGQAFSQTWFLKAHMKKHRGSFDHGCHICGRRFKEPWFLKNHMKAHGP KTGSKNRPKSELDPIATINNVVQEEVIVAGLSLYEVCAKCGNLFTNLDSLNAHNAIHRRVEASRTRAPAEEGAEGPSDTKQFFLQCLNLRPSAAGDSCPG TQAGRRVAELDPVNSYQAWQLATRGKVAEPAEYLKYGAWDEALAGDVAFDKDRREYVLVSQEKRKREQDAPAAQGPPRKRASGPGDPAPAGHLDPRSAAR PNRRAAATTGQGKSSECFECGKIFRTYHQMVLHSRVHRRARRERDSDGDRAARARCGSLSEGDSASQPSSPGSACAAADSPGSGLADEAAEDSGEEGAPE PAPGGQPRRCCFSEEVTSTELSSGDQSHKMGDNASERDTGESKAGIAASVSILENSSRETSRRQEQHRFSMDLKMPAFHPKQEVPVPGDGVEFPSSTGAE GQTGHPAEKLSDLHNKEHSGGGKRALAPDLMPLDLSARSTRDDPSNKETASSLQAALVVHPCPYCSHKTYYPEVLWMHKRIWHRVSCNSVAPPWIQPNGY KSIRSNLVFLSRSGRTGPPPALGGKECQPLLLARFTRTQVPGGMPGSKSGSSPLGVVTKAASMPKNKESHSGGPCALWAPGPDGYRQTKPCHGQEPHGAA TQGPLAKPRQEASSKPVPAPGGGGFSRSATPTPTVIARAGAQPSANSKPVEKFGVPPAGAGFAPTNKHSAPDSLKAKFSAQPQGPPPAKGEGGAPPLPPR EPPSKAAQELRTLATCAAGSRGDAALQAQPGVAGAPPVLHSIKQEPVAEGHEKRLDILNIFKTYIPKDFATLYQGWGVSGPGLEHRGTLRTQARPGEFVC IECGKSFHQPGHLRAHMRAHSVVFESDGPRGSEVHTTSADAPKQGRDHSNTGTVQTVPLRKGT*
Price: £125.00
Completion Time: 
45
Wild-type or Mutant: 
New Protein: 
Yes
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

FOXD2

DU Number: 
DU29388
Plasmid: 
pCS2+-DU-HA-FOXD2 S96E
Expressed: 
HA-FOXD2 S96E
Genbank: 
NM_004474.3 → NP_004465.3 Gene 2306
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGACCCTGGGCAGCTGCTGCTGCGAGATCATGTCCTCCGAGAG CTCCCCGGCCGCGCTGTCCGAGGCCGACGCAGACATAGACGTGGTGGGCG GCGGCAGCGGCGGGGGGGAGCTCCCAGCTCGCTCCGGGCCCCGCGCCCCC CGGGACGTGCTCCCCCACGGCCACGAGCCTCCCGCGGAGGAAGCCGAGGC AGACTTAGCCGAGGACGAGGAGGAGTCTGGTGGCTGCTCGGACGGCGAGC CCCGCGCTCTGGCGTCCCGGGGGGCGGCGGCCGCAGCGGGGgaaCCGGGG CCAGGCGCCGCGGCGGCCCGCGGCGCAGCGGGGCCCGGGCCGGGACCGCC GTCGGGGGGCGCGGCGACGCGGAGCCCGCTGGTGAAGCCGCCCTACTCGT ACATCGCGCTCATCACCATGGCCATCCTGCAGAGCCCCAAGAAGCGGCTG ACGTTGAGCGAGATCTGCGAGTTCATCAGCGGCCGCTTCCCCTACTACCG GGAGAAGTTCCCCGCCTGGCAGAACAGCATCCGCCACAACCTCTCTCTCA ACGACTGCTTCGTCAAGATCCCCCGCGAGCCGGGCAACCCGGGCAAGGGC AACTACTGGACGCTGGACCCGGAGTCGGCCGACATGTTCGACAACGGCAG CTTCCTGCGGCGTCGCAAGCGCTTCAAGCGGCAGCCCCTGCCGCCGCCGC ACCCACACCCGCACCCTCACCCGGAGCTGCTGCTGCGTGGCGGGGCCGCG GCGGCGGGGGATCCCGGCGCTTTCCTGCCCGGCTTCGCTGCCTACGGCGC CTACGGCTACGGCTACGGGCTGGCTCTCCCGGCCTACGGCGCACCCCCGC CGGGGCCGGCCCCGCATCCGCACCCGCACCCGCACCCGCACGCCTTCGCT TTCGCCGCGGCAGCCGCCGCCGCTCCTTGCCAGCTGTCGGTACCCCCAGG CCGCGCCGCCGCGCCTCCACCCGGACCTCCGACGGCCTCGGTGTTCGCAG GCGCGGGATCGGCCCCAGCTCCTGCGCCTGCCTCAGGCTCGGGCCCGGGC CCGGGCCCCGCAGGCCTGCCCGCCTTCCTGGGCGCGGAGCTGGGCTGCGC CAAAGCCTTCTACCCGGCGTCCCTGAGTCCTCCCGCAGCCGGCACCGCGG CGGGTCTGCCCACCGCACTTCTGCGCCAGGGCCTCAAGACGGACGCGGGC GGTGGTGCAGGCGGCGGGGGCGCCGGGGCAGGGCAGAGGCCTTCCTTCTC TATAGACCACATCATGGGCCACGGGGGCGGCGGGGCAGCACCCCCGGGCG CCGGCGAGGGCTCTCCGGGACCGCCATTCGCGGCAGCCGCGGGTCCTGGG GGCCAAGCCCAGGTCTTGGCCATGCTGACTGCTCCGGCCCTGGCTCCCGT TGCTGGCCACATTCGCCTCTCGCATCCCGGGGACGCGCTGCTGTCCTCAG GGTCCCGGTTTGCCAGCAAAGTCGCCGGCCTTAGTGGCTGCCACTTCTGA ctcgag
Amino Acid Sequence: 
MYPYDVPDYAGSPGEFMTLGSCCCEIMSSESSPAALSEADADIDVVGGGS GGGELPARSGPRAPRDVLPHGHEPPAEEAEADLAEDEEESGGCSDGEPRA LASRGAAAAAGEPGPGAAAARGAAGPGPGPPSGGAATRSPLVKPPYSYIA LITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDC FVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLPPPHPH PHPHPELLLRGGAAAAGDPGAFLPGFAAYGAYGYGYGLALPAYGAPPPGP APHPHPHPHPHAFAFAAAAAAAPCQLSVPPGRAAAPPPGPPTASVFAGAG SAPAPAPASGSGPGPGPAGLPAFLGAELGCAKAFYPASLSPPAAGTAAGL PTALLRQGLKTDAGGGAGGGGAGAGQRPSFSIDHIMGHGGGGAAPPGAGE GSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSR FASKVAGLSGCHF*
Price: £125.00
Completion Time: 
214
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801568.R1013
Extra Protein: 
No
Cleavage Site: 

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.