Wild-Type, Truncated

UBXN-3-∆527 (worm)

cDNA Synonyms: 
CELE_F48A11.5
DU Number: 
DU73335
Plasmid: 
pK27SUMO
Expressed: 
UBXN-3-∆527 (worm)
Genbank: 
NP_001022181.2
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
AEIINVKF RLPEGGQDMRRFRRLESIQTLINYLSSKGYSPDKFKYFNSDFPKKEITRHFDLSHNFADT KWPAREQIFVEEI
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
117127.D.C001.2287.1046
Extra Protein: 
No
Cleavage Site: 
SENP
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

UBXN-3-∆435 (worm)

cDNA Synonyms: 
CELE_F48A11.5
DU Number: 
DU73334
Plasmid: 
pK27SUMO
Expressed: 
UBXN-3-∆435 (worm)
Genbank: 
NP_001022181.2
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
LSGVSEYSDIRMNEQSERREREEREAIRNQQEAEYKASLAADKA RMEAKQQEIEEQRLEEERKLREEEEECVRRQTVASTVPEEPPASAPLAEIINVKFRLPEG GQDMRRFRRLESIQTLINYLSSKGYSPDKFKYFNSDFPKKEITRHFDLSHNFADTKWPAR EQIFVEEI
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
117127.D.C001.2287.1046
Extra Protein: 
No
Cleavage Site: 
SENP
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

UBXN7-∆UBX (Human)

cDNA Synonyms: 
KIAA0794, UBXD7
DU Number: 
DU73333
Plasmid: 
pK27SUMO
Expressed: 
UBXN7-∆UBX (Human)
Genbank: 
NP_056377.1
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MAAHGGSAASSALKGLIQQFTTITGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPS TSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIR QEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFAC QCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLV EWHQLDVSSFLDQVTGFLGEHGQLDGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQE THFDSTQTKQDSRSDEESESELFSGSEEFISVCGSDEEEEVENLAKSRKSPHKDLGHRKE ENRRPLTEPPVRTDPGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGP
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
117127.D.C001.2287.1046
Extra Protein: 
No
Cleavage Site: 
SENP
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

UBXN7-∆UIM (Human)

cDNA Synonyms: 
KIAA0794, UBXD7
DU Number: 
DU73332
Plasmid: 
pK27SUMO
Expressed: 
UBXN7-∆UIM (Human)
Genbank: 
NP_056377.1
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MAAHGGSAASSALKGLIQQF TTITGASESVGKHMLEACNN NLEMAVTMFLDGGGIAEEPS TSSASVSTVRPHTEEEVRAP IPQKQEILVEPEPLFGAPKR RRPARSIFDGFRDFQTETIR QEQELRNGGAIDKKLTTLAD LFRPPIDLMHKGSFETAKEC GQMQNKWLMINIQNVQDFAC QCLNRDVWSNEAVKNIIREH FIFWQVYHDSEEGQRYIQFY KLGDFPYVSILDPRTGQKLV EWHQLDVSSFLDQVTGFLGE HGQLDGLSSSPPKKCARSES LIDASTQTKQDSRSDEESES ELFSGSEEFISVCGSDEEEE VENLAKSRKSPHKDLGHRKE ENRRPLTEPPVRTDPGTATN HQGLPAVDSEILEMPPEKAD GVVEGIDVNGPKAQLMLRYP DGKREQITLPEQAKLLALVK HVQSKGYPNERFELLTNFPR RKLSHLDYDITLQEAGLCPQ ETVFVQERN*
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
117127.D.C001.2287.1046
Extra Protein: 
No
Cleavage Site: 
SENP
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

UBXN7-∆UBA (Human)

cDNA Synonyms: 
KIAA0794, UBXD7
DU Number: 
DU73331
Plasmid: 
pK27SUMO
Expressed: 
UBXN7-∆UBA (Human)
Genbank: 
NP_056377.1
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
IAEEPS TSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIR QEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFAC QCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLV EWHQLDVSSFLDQVTGFLGEHGQLDGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQE THFDSTQTKQDSRSDEESESELFSGSEEFISVCGSDEEEEVENLAKSRKSPHKDLGHRKE ENRRPLTEPPVRTDPGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYP DGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQ ETVFVQERN
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
117127.D.C001.2287.1046
Extra Protein: 
No
Cleavage Site: 
SENP
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

UBXN7-∆148 (Human)

cDNA Synonyms: 
KIAA0794, UBXD7
DU Number: 
DU73330
Plasmid: 
pK27SUMO
Expressed: 
UBXN7-∆148 (Human)
Genbank: 
NP_056377.1
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MHKGSFETAKECGQMQNKWLMINIQNVQDFAC QCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLV EWHQLDVSSFLDQVTGFLGEHGQLDGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQE THFDSTQTKQDSRSDEESESELFSGSEEFISVCGSDEEEEVENLAKSRKSPHKDLGHRKE ENRRPLTEPPVRTDPGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYP DGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQ ETVFVQERN
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
117127.D.C001.2287.1046
Extra Protein: 
No
Cleavage Site: 
SENP
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

FAF2-∆UBX∆T (Human)

cDNA Synonyms: 
ETEA, KIAA0887, UBXD8, UBXN3B
DU Number: 
DU73327
Plasmid: 
pK27SUMO
Expressed: 
FAF2-∆UBX∆T (Human)
Genbank: 
NP_055428.1
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MAAPEERDLTQEQTEKLLQF QDLTGIESMDQCRHTLEQHN WNIEAAVQDRLNEQEGVPSV FNPPPSRPLQVNTADHRIYS YVVSRPQPRRFIRPDPRSRV TDPVGDIVSFMHSFEEKYGR AHPVFYQGTYSQALNDAKRE LRFLLVYLHGDDHQDSDEFC RNTLCAPEVISLINTRMLFW ACSTNKPEGYRVSQALRENT YPFLAMIMLKDRRMTVVGRL EGLIQPDDLINQLTFIMDAN QTYLVSERLEREERNQTQVL RQQQDEAYLASLRADQEKER KKREERERKRRKEEEVQQQK LAEERRRQNLQEEKERKLEC LPPEPSPDLTDE*
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
117127.D.C001.2287.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

FAF2-∆CC∆T (Human)

cDNA Synonyms: 
ETEA, KIAA0887, UBXD8, UBXN3B
DU Number: 
DU73326
Plasmid: 
pK27SUMO
Expressed: 
FAF2-∆CC∆T (Human)
Genbank: 
NP_055428.1
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MAAPEERDLTQEQTEKLLQF QDLTGIESMDQCRHTLEQHN WNIEAAVQDRLNEQEGVPSV FNPPPSRPLQVNTADHRIYS YVVSRPQPRRFIRPDPRSRV TDPVGDIVSFMHSFEEKYGR AHPVFYQGTYSQALNDAKRE LRFLLVYLHGDDHQDSDEFC RNTLCAPEVISLINTRMLFW ACSTNKPEGYRVSQALRENT YPFLAMIMLKDRRMTVVGRL EGLIQPDDLINQLTFIMDAN QTYLVSERLEREERNQTQVL RQQQDEAYPPEPSPDDPESV KIIFKLPNDSRVERRFHFSQ SLTVIHDFLFSLKESPEKFQ IEANFPRRVLPCIPSEEWPN PPTLQEAGLSHTEVLFVQDL TDE*
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
117127.D.C001.2287.1046
Extra Protein: 
No
Cleavage Site: 
SENP
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

FAF2 (Human)

cDNA Synonyms: 
ETEA, KIAA0887, UBXD8, UBXN3B
DU Number: 
DU73325
Plasmid: 
pK27SUMO
Expressed: 
FAF2-∆297 (Human)
Genbank: 
NP_055428.1
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
FIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLAS LRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECLPPEPSPDDPE SVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEW PNPPTLQEAGLSHTEVLFVQDLTDE
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
117127.D.C001.2287.1046
Extra Protein: 
No
Cleavage Site: 
SENP
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

FAF2 (Human)

cDNA Synonyms: 
ETEA, KIAA0887, UBXD8, UBXN3B
DU Number: 
DU73324
Plasmid: 
pK27SUMO
Expressed: 
FAF2-∆137 (Human)
Genbank: 
NP_055428.1
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
SFMHSFEEKYGRAHPVFYQGTYSQALNDAKRELRFLLVYLHGD DHQDSDEFCRNTLCAPEVISLINTRMLFWACSTNKPEGYRVSQALRENTYPFLAMIMLKD RRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLAS LRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECLPPEPSPDDPE SVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEW PNPPTLQEAGLSHTEVLFVQDLTDE
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
117127.D.C001.2287.1046
Extra Protein: 
No
Cleavage Site: 
SENP
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.