Uncharacterised Function

53BP1

cDNA Synonyms: 
TP53BP1
p202
DU Number: 
DU75018
Cost of Production: 
200.00
Plasmid: 
pcDNA5 FRT TO 53BP1 L1619A-GFP
Expressed: 
53BP1 L1619A-GFP
Genbank: 
NM_001141980.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVADPVDSSNLDT CGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQDVEENTVPYEVDKEQLQSVTT NSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFSPKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVL STQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSLSTNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEE GGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPPGSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNS PEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISIL ATGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQG LCLQKEMPKKECSEAMEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAEN RLDTKEEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSFCESSS ETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCLRMKLVSPETEASE ESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGDHTIRQSQQPMKPISPVKDPV SPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTER GSGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRHMRTIREVRTLVTRVITDVYYVDGTEVERKVTEETEEPIVECQECETEVSPSQTGGSSGDLG DISSFSSKASSLHRTSSGTSLSAMHSSGSSGKGAGPLRGKTSGTEPADFALPSSRGGPGKLSPRKGVSQTGTPVCEEDGDAGLGIRQGGKAPVTPRGRGR RGRPPSRTTGTRETAVPGPLGIEDISPNLSPDDKSFSRVVPRVPDSTRRTDVGAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRVVAKWSSNGY FYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQY GLGPYEAVTPLTKAADISADNLVEGKRKRRSNVSSPATPTASSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPAKRGRKSATVKPGAVGAGEFV SPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMATTSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAY QCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASV KQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSHAAAMVSKGEELFTGVVPILVELDGDVNG HKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIE LKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFV TAAGITLGMDELYK*
Price: £125.00
Completion Time: 
16
Research Area: 
Diseases: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
Yes
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

53BP1

cDNA Synonyms: 
TP53BP1
p202
DU Number: 
DU73956
Cost of Production: 
200.00
Plasmid: 
pcDNA5 FRT TO 53BP1 S308A HA (custom)
Expressed: 
GFP-53BP1 S308A-HA
Genbank: 
NM_001141980.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene map
Price: £125.00
Completion Time: 
11
Research Area: 
Diseases: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
Yes
Hidden Project: 
Yes
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Restricted Distribution
COVID-19: 
No
Ubiquitylation Site: 
No

FAM83H

cDNA Synonyms: 
AI3
DU Number: 
DU52026
Plasmid: 
pX335 FAM83H KO antisense
Expressed: 
FAM83H KO antisense guide + Cas9n
Genbank: 
NM_198488.3
Species: 
Human
Vector Type: 
Mammalian
Sequence of Insert: 
GTAGTGAGGCGGCAGGTACCC
Price: £125.00
Completion Time: 
18
Research Area: 
Target Family: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

FAM83G

cDNA Synonyms: 
PAWS1
DU Number: 
DU64809
Cost of Production: 
100.00
Plasmid: 
pcDNA5D frtTO Alfa 3C FAM83G
Expressed: 
3xAlfa-3C-FAM83G
Genbank: 
NM_001039999.3
Species: 
Human
Vector Type: 
Mammalian
Sequence of Insert: 
atggccttctctcaggtgcagtgtctggacgacaaccatgtgaactggcgctccagcgagtccaagcctgagttcttctacagcgaggagcagcggctggcgctggaggccctggtggcccgcggccgggacgccttctacgaggtgctcaagcgggagaacatccgagacttcctctcggagctggagctcaagcgcatcctggagaccatcgaggtgtacgacccgggctctgaggaccctcggggcacgggcccctctcaggggcccgaggacaatggggtcggcgacggcgaggaagccagcggggcggatggggtccccatcgaggccgagccgctgccctccctggagtactggccccagaagtcggaccgctccatcccgcagctggacctgggctggcccgacaccatcgcctaccgcggcgtgacccgggctagcgtctacatgcagccccccatagacgggcaggcccacatcaaagaggtggtgcggaagatgatcagccaggcacagaaggtgatagctgtggtcatggacatgttcaccgacgtggacatcttcaaggacctgctggacgccggcttcaagaggaaagtggccgtgtacatcatcgtggatgagagtaacgtcaagtacttcctgcacatgtgtgagcgggcctgcatgcacctggggcacctcaagaatctcagagtgcggagcagcgggggaactgagttcttcacgcggtcggcaaccaagttcaagggtgccctggcccagaagttcatgtttgtggatggagaccgggctgtgtgcggctcctacagcttcacgtggtcggccgcgcggacggaccggaatgtgatctctgtgctgtctggccaggtggtggagatgtttgaccggcagttccaggagctgtacctcatgtcacacagtgtgagcctcaagggcatccctatggagaaggaaccggagccggagcctattgtgctgccctctgtggtccccctggtgcccgcgggcactgtggccaagaagctcgtcaaccccaagtacgcacttgtcaaggccaagagcgtcgacgagattgccaagatctcctctgagaagcaggaggccaagaagcccctggggctgaaaggcccagcgctggctgagcatccaggggaactccccgagctgctgccacccatccacccaggactgcttcacctggagagggccaacatgtttgagtacctgcccacgtgggtggagccagacccggagcctggcagcgacatcctgggctacatcaatatcatcgaccccaacatctggaacccccagcccagccagatgaaccgcatcaagatccgtgacacctcccaggccagcgcccagcaccagctgtggaagcagagccaggacagcaggccccgtccagagccttgccctcccccagagcccagtgccccccaggacggtgtcccagctgagaacggcctcccccagggggaccctgagccattgccccccgtgcccaagccccggacagtccctgtggcagatgtactagcccgggacagcagtgatattggctgggtcctggagctccccaaagaggaagctccccagaatgggacagaccataggctacccaggatggcaggcccaggccacgccccactccagcggcagctatctgtgacccaggatgaccccgagagcctcggggtggggctccccaatgggctggatggggtggaagaagaagatgatgacgactacgtaaccctcagtgaccaggacagccactcaggcagctccggccgtggccctggcccccgacggccctcagtggcttcctctgtgtcagaggagtacttcgaggtgagagagcactcagtccctctccggaggcgccactcagagcaagtggccaacgggccaaccccaccaccgcgccggcagctgagtgccccccatataacccgagggacctttgttggaccccagggtggctccccatgggcccagagtcggggaagagaagaagcagatgcgttgaagaggatgcaggcccagcgctccacagacaaggaggcacagggccagcagtttcatcatcacagggtccctgcctcagggactagggataaagacggcttcccaggaccccctaggtaccgctctgctgctgacagcgtccagagctctaccagaaacgctggcccagccatggctggcccccaccactggcaggccaagggaggtcaggtaccccgcctgcttccggatcccggcagcccaagactggcccaaaatgcccgccccatgaccgatggcagggccaccgaggagcatccgagtcccttcggaatcccatactccaaactgtctcagtcgaagcacctaaaggccaggacgggcggtagccagtgggcctcatcggattctaaacggagggctcaagccccccgggaccgcaaagacccctaggcggccgc
Amino Acid Sequence: 
MPSRLEEELRRRLTEPPSRLEEELRRRLTEPPSRLEEELRRRLTEPLEVLFQGPMAFSQVQCLDDNHVNWRSSESKPEFFYSEEQRLALEALVARGRDAF YEVLKRENIRDFLSELELKRILETIEVYDPGSEDPRGTGPSQGPEDNGVGDGEEASGADGVPIEAEPLPSLEYWPQKSDRSIPQLDLGWPDTIAYRGVTR ASVYMQPPIDGQAHIKEVVRKMISQAQKVIAVVMDMFTDVDIFKDLLDAGFKRKVAVYIIVDESNVKYFLHMCERACMHLGHLKNLRVRSSGGTEFFTRS ATKFKGALAQKFMFVDGDRAVCGSYSFTWSAARTDRNVISVLSGQVVEMFDRQFQELYLMSHSVSLKGIPMEKEPEPEPIVLPSVVPLVPAGTVAKKLVN PKYALVKAKSVDEIAKISSEKQEAKKPLGLKGPALAEHPGELPELLPPIHPGLLHLERANMFEYLPTWVEPDPEPGSDILGYINIIDPNIWNPQPSQMNR IKIRDTSQASAQHQLWKQSQDSRPRPEPCPPPEPSAPQDGVPAENGLPQGDPEPLPPVPKPRTVPVADVLARDSSDIGWVLELPKEEAPQNGTDHRLPRM AGPGHAPLQRQLSVTQDDPESLGVGLPNGLDGVEEEDDDDYVTLSDQDSHSGSSGRGPGPRRPSVASSVSEEYFEVREHSVPLRRRHSEQVANGPTPPPR RQLSAPHITRGTFVGPQGGSPWAQSRGREEADALKRMQAQRSTDKEAQGQQFHHHRVPASGTRDKDGFPGPPRYRSAADSVQSSTRNAGPAMAGPHHWQA KGGQVPRLLPDPGSPRLAQNARPMTDGRATEEHPSPFGIPYSKLSQSKHLKARTGGSQWASSDSKRRAQAPRDRKDP*
Price: £125.00
Completion Time: 
7
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811523.R10
Extra Protein: 
No
Cleavage Site: 
PreScission
Restricted Distribution: 
Not Restricted

MPLKIP

cDNA Synonyms: 
TTDN1; ABHS; C7orf11; ORF20; TTD4
DU Number: 
DU67235
Plasmid: 
pcDNA5D FRT/TO GFP MPLKIP
Expressed: 
GFP MPLKIP
Genbank: 
NM_138701.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCAGCGACAGAATTTTCGGCCCCCAACTCCTCCTTACCCTGGTCCGGGTGGAGGAGGTTGGGGTAGCGGAAGCAGCTTCCGGGGAACCCCGGGCGGGGGCGGACCACGGCCGCCCTCCCCTCGAGACGGGTACGGGAGTCCGCACCACACGCCGCCGTACGGGCCCCGGTCTAGGCCGTACGGGAGCAGTCACTCTCCGCGACACGGCGGCAGCTTCCCGGGGGGCCGGTTCGGGTCTCCGTCCCCTGGCGGCTACCCTGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCAGCAATTCGGCTACTCCCCAGGGCAGCAGCAGACCCACCCCCAGGGTTCTCCAAGGACATCTACACCATTTGGATCAGGGCGTGTTAGAGAAAAAAGAATGTCTAATGAGTTGGAAAATTATTTCAAGCCTTCAATGCTTGAAGATCCTTGGGCTGGCCTAGAACCAGTATCTGTAGTGGATATAAGCCAACAATACAGCAATACTCAAACATTCACAGGCAAAAAAGGAAGATACTTTTGTTAAGCGGCCGC
Amino Acid Sequence: 
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGP RSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVS VVDISQQYSNTQTFTGKKGRYFC*
Price: £125.00
Completion Time: 
20
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

MPLKIP

cDNA Synonyms: 
TTDN1; ABHS; C7orf11; ORF20; TTD4
DU Number: 
DU67234
Plasmid: 
pBabeD puro GFP MPLKIP
Expressed: 
GFP MPLKIP
Genbank: 
NM_138701.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCAGCGACAGAATTTTCGGCCCCCAACTCCTCCTTACCCTGGTCCGGGTGGAGGAGGTTGGGGTAGCGGAAGCAGCTTCCGGGGAACCCCGGGCGGGGGCGGACCACGGCCGCCCTCCCCTCGAGACGGGTACGGGAGTCCGCACCACACGCCGCCGTACGGGCCCCGGTCTAGGCCGTACGGGAGCAGTCACTCTCCGCGACACGGCGGCAGCTTCCCGGGGGGCCGGTTCGGGTCTCCGTCCCCTGGCGGCTACCCTGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCAGCAATTCGGCTACTCCCCAGGGCAGCAGCAGACCCACCCCCAGGGTTCTCCAAGGACATCTACACCATTTGGATCAGGGCGTGTTAGAGAAAAAAGAATGTCTAATGAGTTGGAAAATTATTTCAAGCCTTCAATGCTTGAAGATCCTTGGGCTGGCCTAGAACCAGTATCTGTAGTGGATATAAGCCAACAATACAGCAATACTCAAACATTCACAGGCAAAAAAGGAAGATACTTTTGTTAAGCGGCCGC
Amino Acid Sequence: 
MHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI FFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDN HYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYG PRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPV SVVDISQQYSNTQTFTGKKGRYFC*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

MPLKIP

cDNA Synonyms: 
TTDN1; ABHS; C7orf11; ORF20; TTD4
DU Number: 
DU67233
Plasmid: 
pBabeD puro 3FLAG MPLKIP
Expressed: 
3FLAG MPLKIP
Genbank: 
NM_138701.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCAGCGACAGAATTTTCGGCCCCCAACTCCTCCTTACCCTGGTCCGGGTGGAGGAGGTTGGGGTAGCGGAAGCAGCTTCCGGGGAACCCCGGGCGGGGGCGGACCACGGCCGCCCTCCCCTCGAGACGGGTACGGGAGTCCGCACCACACGCCGCCGTACGGGCCCCGGTCTAGGCCGTACGGGAGCAGTCACTCTCCGCGACACGGCGGCAGCTTCCCGGGGGGCCGGTTCGGGTCTCCGTCCCCTGGCGGCTACCCTGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCAGCAATTCGGCTACTCCCCAGGGCAGCAGCAGACCCACCCCCAGGGTTCTCCAAGGACATCTACACCATTTGGATCAGGGCGTGTTAGAGAAAAAAGAATGTCTAATGAGTTGGAAAATTATTTCAAGCCTTCAATGCTTGAAGATCCTTGGGCTGGCCTAGAACCAGTATCTGTAGTGGATATAAGCCAACAATACAGCAATACTCAAACATTCACAGGCAAAAAAGGAAGATACTTTTGTTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPG GRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKG RYFC*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

SH3D21

cDNA Synonyms: 
C1orf113
DU Number: 
DU68069
Plasmid: 
pCMV5D SH3D21 GFP
Expressed: 
SH3D21 GFP
Genbank: 
NM_001162530.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGGAAGTCCTCGTCCTGGCCGGATACCGCGCGCAGAAGGAGGACGAGCTGAGTCTGGCGCCCGGGGACGTAGTCCGGCAGGTGCGCTGGGTGCCCGCGCGGGGCTGGCTTCGCGGAGAGTTTGGGGGCCGCTATGGCCTCTTCCCCGAGCGCCTGGTGCAGGAGATCCCAGAGACCCTGCGGGGCTCCGGAGAGGCGCGGAGGCCGCGCTGTGCGCGCCGCCGAGGTCATCCTGCCAAACACCCGAGGCCCCAAAGATGGTGCAAAGTGAACTTCAGCTACAGCCCAGAGCAGGCGGACGAGCTGAAGCTGCAAGCTGGGGAGATCGTGGAAATGATAAAGGAGATTGAGGACGGCTGGTGGCTGGGGAAGAAGAACGGGCAGCTGGGAGCCTTCCCATCCAACTTTGTGGAATTGCTGGACAGTGGGCCCCCAAGCCTTGGTAACCCAGACATGCCTTCAGTCAGCCCGGGTCCCCAGCGGCCTCCCAAGCTGAGCAGCCTGGCCTATGACAGCCCTCCAGACTACCTGCAGACAGTCTCCCACCCTGAGGTCTACAGGGTCCTGTTTGACTACCAGCCTGAGGCCCCAGACGAGTTGGCGCTGCGGAGGGGGGACGTGGTAAAAGTACTCAGCAAGACCACAGAGGATAAGGGCTGGTGGGAAGGAGAGTGTCAAGGACGAAGAGGAGTTTTTCCAGACAACTTTGTACTCCCACCACCCCCAATCAAGAAGCTGGTCCCACGGAAAGTGGTATCTCGGGAATCAGCTCCTATTAAGGAACCAAAAAAGTTGATGCCCAAAACATCCCTCCCCACAGTCAAGAAGCTAGCAACAGCCACCACTGGGCCCAGCAAAGCCAAGACATCTCGGACACCCAGCAGGGACAGTCAGAAGCTCACCTCCCGAGACTCAGGCCCCAATGGTGGCTTCCAAAGTGGGGGTTCGTATCACCCTGGCCGAAAGCGATCCAAAACCCAGACTCCCCAGCAACGCTCTGTGTCCAGTCAGGAGGAAGAGCACAGCAGCCCGGTAAAGGCCCCCTCTGTGAAGAGAACCCCCATGCCGGACAAGACTGCCACCCCAGAGAGGCCCCCAGCTCCAGAGAACGCCCCCAGCTCCAAGAAGATCCCGGCTCCTGACAAAGTCCCCTCCCCAGAGAAGACCCTCACTCTAGGGGACAAGGCCTCTATCCCAGGGAACTCCACCTCGGGGAAGATCCCAGCTCCTGACAAAGTCCCCACCCCAGAGAAGATGGTGACTCCGGAGGACAAGGCTTCTATCCCAGAGAACTCCATCATCCCAGAGGAGACCCTGACTGTGGACAAACCCTCCACTCCAGAGAGGGTCTTTTCAGTGGAAGAGTCCCCTGCCCTAGAAGCCCCACCTATGGATAAAGTCCCTAATCCAAAGATGGCCCCTCTGGGGGATGAGGCCCCCACTCTAGAAAAGGTCTTGACCCCAGAGCTTTCTGAAGAAGAGGTGTCCACCAGAGATGACATTCAATTCCATCACTTCTCTTCGGAGGAAGCCCTGCAGAAGGTCAAGTACTTTGTAGCCAAAGAGGATCCATCATCCCAGGAGGAGGCCCACACGCCAGAGGCACCCCCACCCCAGCCTCCTTCCTCAGAGAGGTGCCTGGGAGAGATGAAATGTACCCTAGTTAGAGGGGACAGCTCCCCACGCCAGGCTGAGTTGAAGTCTGGGCCAGCATCCAGGCCTGCCCTTGAGAAGCCCCACCCCCACGAAGAGGCTACAACCCTTCCAGAGGAGGCACCTTCCAATGACGAGAGGACCCCTGAAGAGGAGGCGCCCCCCAACGAGCAGAGGCCTCTGAGAGAGGAGGTGCTCCCCAAAGAGGGAGTGGCTTCCAAAGAGGAGGTGACCCTGAAAGAGGAATTGCCCCCTAAAGAGGAAGTGGCTCCAAAAGAGGAGGTGCCCCCCATAGAAAGAGCCTTTGCCCAAAAAACACGTCCTATCAAGCCGCCTCCAGACTCCCAAGAGACGCTCGCGCTCCCCTCGCTGGTCCCGCAAAACTACACGGAAAACAAGAATGAAGGAGTTGATGTAACGTCGCTGAGGGGCGAGGTGGAGTCTCTAAGGAGGGCGCTGGAGCTGATGGAGGTGCAGCTGGAGAGGAAGCTGACCGACATCTGGGAGGAGCTGAAGAGCGAGAAGGAGCAGCGCCGGCGGCTGGAGGTCCAGGTGATGCAGGGGACCCAGAAGTCCCAGACCCCGCGCGTCATCCACACGCAGACGCAGACCTAC
Amino Acid Sequence: 
MEVLVLAGYRAQKEDELSLAPGDVVRQVRWVPARGWLRGEFGGRYGLFPERLVQEIPETLRGSGEARRPRCARRRGHPAKHPRPQRWCKVNFSYSPEQADELKLQAGEIVEMIKEIEDGWWLGKKNGQLGAFPSNFVELLDSGPPSLGNPDMPSVSPGPQRPPKLSSLAYDSPPDYLQTVSHPEVYRVLFDYQPEAPDELALRRGDVVKVLSKTTEDKGWWEGECQGRRGVFPDNFVLPPPPIKKLVPRKVVSRESAPIKEPKKLMPKTSLPTVKKLATATTGPSKAKTSRTPSRDSQKLTSRDSGPNGGFQSGGSYHPGRKRSKTQTPQQRSVSSQEEEHSSPVKAPSVKRTPMPDKTATPERPPAPENAPSSKKIPAPDKVPSPEKTLTLGDKASIPGNSTSGKIPAPDKVPTPEKMVTPEDKASIPENSIIPEETLTVDKPSTPERVFSVEESPALEAPPMDKVPNPKMAPLGDEAPTLEKVLTPELSEEEVSTRDDIQFHHFSSEEALQKVKYFVAKEDPSSQEEAHTPEAPPPQPPSSERCLGEMKCTLVRGDSSPRQAELKSGPASRPALEKPHPHEEATTLPEEAPSNDERTPEEEAPPNEQRPLREEVLPKEGVASKEEVTLKEELPPKEEVAPKEEVPPIERAFAQKTRPIKPPPDSQETLALPSLVPQNYTENKNEGVDVTSLRGEVESLRRALELMEVQLERKLTDIWEELKSEKEQRRRLEVQVMQGTQKSQTPRVIHTQTQTYAAAMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*
Price: £125.00
Completion Time: 
112
Wild-type or Mutant: 
New Protein: 
Yes
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R106
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

MPLKIP

cDNA Synonyms: 
TTDN1; ABHS; C7orf11; ORF20; TTD4
DU Number: 
DU67232
Plasmid: 
pcDNA5 FRT/TO 3FLAG MPLKIP
Expressed: 
3FLAG MPLKIP
Genbank: 
NM_138701.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCAGCGACAGAATTTTCGGCCCCCAACTCCTCCTTACCCTGGTCCGGGTGGAGGAGGTTGGGGTAGCGGAAGCAGCTTCCGGGGAACCCCGGGCGGGGGCGGACCACGGCCGCCCTCCCCTCGAGACGGGTACGGGAGTCCGCACCACACGCCGCCGTACGGGCCCCGGTCTAGGCCGTACGGGAGCAGTCACTCTCCGCGACACGGCGGCAGCTTCCCGGGGGGCCGGTTCGGGTCTCCGTCCCCTGGCGGCTACCCTGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCAGCAATTCGGCTACTCCCCAGGGCAGCAGCAGACCCACCCCCAGGGTTCTCCAAGGACATCTACACCATTTGGATCAGGGCGTGTTAGAGAAAAAAGAATGTCTAATGAGTTGGAAAATTATTTCAAGCCTTCAATGCTTGAAGATCCTTGGGCTGGCCTAGAACCAGTATCTGTAGTGGATATAAGCCAACAATACAGCAATACTCAAACATTCACAGGCAAAAAAGGAAGATACTTTTGTTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGG SFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFT GKKGRYFC*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
PMID: 
rouse-CDKL5-paper-3

RAB13

cDNA Synonyms: 
GIG4
DU Number: 
DU67122
Plasmid: 
pcDNA5D FRT/TO GFP RAB13 S186A
Expressed: 
GFP RAB13 S186A
Genbank: 
NM_002870.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCCAAAGCCTACGACCACCTCTTCAAGTTGCTGCTGATCGGGGACTCGGGGGTGGGCAAGACTTGTCTGATCATTCGCTTTGCAGAGGACAACTTCAACAACACTTACATCTCCACCATCGGAATTGATTTCAAGATCCGCACTGTGGATATAGAGGGGAAGAAGATCAAACTACAAGTCTGGGACACGGCTGGCCAAGAGCGGTTCAAGACAATAACTACTGCCTACTACCGTGGAGCCATGGGCATTATCCTAGTATACGACATCACGGATGAGAAATCTTTCGAGAATATTCAGAACTGGATGAAAAGCATCAAGGAGAATGCCTCGGCTGGGGTGGAGCGCCTCTTGCTGGGGAACAAATGTGACATGGAGGCCAAGAGGAAGGTGCAGAAGGAGCAGGCCGATAAGTTGGCTCGAGAGCATGGAATCCGATTTTTCGAAACTAGTGCTAAATCCAGTATGAATGTGGATGAGGCTTTTAGTTCCCTGGCCCGGGACATCTTGCTCAAGTCAGGAGGCCGGAGATCAGGAAACGGCAACAAGCCTCCCGCCACTGACCTGAAAACTTGTGACAAGAAGAACACCAACAAGTGCTCCCTGGGCTGAGCGGCCGC
Amino Acid Sequence: 
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKK IKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSM NVDEAFSSLARDILLKSGGRRSGNGNKPPATDLKTCDKKNTNKCSLG*
Price: £125.00
Completion Time: 
7
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.