Kinase substrates

PEAK3

DU Number: 
DU68617
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO HA PEAK3 S49A
Expressed: 
HA-PEAK3 S49A
Genbank: 
NM_198532.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
ggatctATGAGCAGCCCGGAGCCCCCCACAGAGCCCCCCGAGCCCGACAACCCCACCTGGTCGACTCAGCCCACGTATAGCAACCTTGGTCAGATCCGTGCCCACCTGCTGCCCTCCAAGGCCTGCCGCCTCCGGACCCCTGGGTCCCTCgCCACCAACCCAGAGCCCCTGCCCCCACCCCTGCCCAAGAAGATCCTAACCCGGACCCAGTCACTGCCCACCCGCAGGACCCTCCATCCCAGCTCCATCCAAGTACAGCCGCCTCGGAGACCCTTTCTGGGGTCCCACAGTGTGGACAAGAGCCAGGCTGCAGTGGGACCAGCCTGTCTCCCTGCAGAGCTGACCTTTGGCCCGGCTGACGCCCCACTGGGCCTCTCCCTCCGCGATCTGCACAGCCCGGAGGCTGTGCACACTGCACTGGCTGCGCGGCAGCTGCAGGGCCTCCGTACCATCTATGCCCGGCTCCGTGCCCGGCTCATGGGGGGCCACCCCGGGCCCTGCCACCCCGGCCACAGCTTCCGCCTCCTAGACAGCTCACCCTGCGCAGAGAGCGGGGACGCCCTGTATTACCGCGTGGTGCGCGCGCACGAGGACGCCTGGCACATCCTGGTCGCCAAGGTGCCCAAGCCCGGGGCGGACGTGCCCCACCCGTGGGGCCTGGAGCTGCAGGCCTCCCTGTCTCCACACTTCAATCTGCAGGGGCTGTGTGGCCTGGTGCCTGAAGGCACACTGCCCGGGGCGCCCTGGAGAGGCGCAGTGGCGCTGGCAGCCGAGGTTCCAGAGCGCACGGTGGCGCAGTGGCTGGCGGAGGCCTGCACGCAGCCGCCGGAGGAGTTCGTGTGGGCTGTGGCCCTGCTGCTGCTGCAGCTGAGCGCGGCCCTGAAGTTCCTGGAGGCGTGGGGCGCGGCCCTAGTCGAGTTGCGGCCGGAGAACTTGCTGCTGGTGGCACCTCGGGGCTGTGCGACGACGGGGCCCCCACGCCTGCTCCTCACTGACTTTGGCCGCGTCTGTCTGCAGCCCCCTGGACCCCCGGGATCCCCGGGCCCCCACGCGCCGCAGCTGGGCAGCCTCCTCCGAGCGCTGCTCAGCCTTGCTGCGCCCTCGACCACGCCTTTGGCCGCGGGCCTGGAGCTCCTGGCAGCACAGCTGACCCGCTTGCGGCCCTCGGCGTCCCGGACGCGGGGCGCGCTGCAGGCGCTGCTCTGGGGGCCCGGGCCTGAGCTGCGCGGCCGCGGAGCACCGCTTGGTCCCTGGCTCCGAGCGCTCGGGCCCTGGCTGCGGGTGCGCCGCGGGCTGCTGGTCCTGCGCCTAGCAGAGCGGGCCGCAGGTGGGGAAGCTCCCAGCCTCGAGGACTGGCTGTGTTGCGAATACCTGGCCGAGGCCACCGAGTCCTCGATGGGCCAGGCCCTGGCGCTGCTGTGGGACTGAgaattc
Amino Acid Sequence: 
MYPYDVPDYAGSMSSPEPPTEPPEPDNPTWSTQPTYSNLGQIRAHLLPSKACRLRTPGSLATNPEPLPPPLPKKILTRTQSLPTRRTLHPSSIQVQPPRR PFLGSHSVDKSQAAVGPACLPAELTFGPADAPLGLSLRDLHSPEAVHTALAARQLQGLRTIYARLRARLMGGHPGPCHPGHSFRLLDSSPCAESGDALYY RVVRAHEDAWHILVAKVPKPGADVPHPWGLELQASLSPHFNLQGLCGLVPEGTLPGAPWRGAVALAAEVPERTVAQWLAEACTQPPEEFVWAVALLLLQL SAALKFLEAWGAALVELRPENLLLVAPRGCATTGPPRLLLTDFGRVCLQPPGPPGSPGPHAPQLGSLLRALLSLAAPSTTPLAAGLELLAAQLTRLRPSA SRTRGALQALLWGPGPELRGRGAPLGPWLRALGPWLRVRRGLLVLRLAERAAGGEAPSLEDWLCCEYLAEATESSMGQALALLWD*
Price: £125.00
Completion Time: 
35
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811390.R10
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No

PEAK3

DU Number: 
DU68616
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO HA PEAK3 T44A S47A S49A T50A
Expressed: 
HA PEAK3 T44A S47A S49A T50A
Genbank: 
NM_198532.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
ATGAGCAGCCCGGAGCCCCCCACAGAGCCCCCCGAGCCCGACAACCCCACCTGGTCGACTCAGCCCACGTATAGCAACCTTGGTCAGATCCGTGCCCACCTGCTGCCCTCCAAGGCCTGCCGCCTCCGGgCCCCTGGGgcaCTCgCCgcgAACCCAGAGCCCCTGCCCCCACCCCTGCCCAAGAAGATCCTAACCCGGACCCAGTCACTGCCCACCCGCAGGACCCTCCATCCCAGCTCCATCCAAGTACAGCCGCCTCGGAGACCCTTTCTGGGGTCCCACAGTGTGGACAAGAGCCAGGCTGCAGTGGGACCAGCCTGTCTCCCTGCAGAGCTGACCTTTGGCCCGGCTGACGCCCCACTGGGCCTCTCCCTCCGCGATCTGCACAGCCCGGAGGCTGTGCACACTGCACTGGCTGCGCGGCAGCTGCAGGGCCTCCGTACCATCTATGCCCGGCTCCGTGCCCGGCTCATGGGGGGCCACCCCGGGCCCTGCCACCCCGGCCACAGCTTCCGCCTCCTAGACAGCTCACCCTGCGCAGAGAGCGGGGACGCCCTGTATTACCGCGTGGTGCGCGCGCACGAGGACGCCTGGCACATCCTGGTCGCCAAGGTGCCCAAGCCCGGGGCGGACGTGCCCCACCCGTGGGGCCTGGAGCTGCAGGCCTCCCTGTCTCCACACTTCAATCTGCAGGGGCTGTGTGGCCTGGTGCCTGAAGGCACACTGCCCGGGGCGCCCTGGAGAGGCGCAGTGGCGCTGGCAGCCGAGGTTCCAGAGCGCACGGTGGCGCAGTGGCTGGCGGAGGCCTGCACGCAGCCGCCGGAGGAGTTCGTGTGGGCTGTGGCCCTGCTGCTGCTGCAGCTGAGCGCGGCCCTGAAGTTCCTGGAGGCGTGGGGCGCGGCCCTAGTCGAGTTGCGGCCGGAGAACTTGCTGCTGGTGGCACCTCGGGGCTGTGCGACGACGGGGCCCCCACGCCTGCTCCTCACTGACTTTGGCCGCGTCTGTCTGCAGCCCCCTGGACCCCCGGGATCCCCGGGCCCCCACGCGCCGCAGCTGGGCAGCCTCCTCCGAGCGCTGCTCAGCCTTGCTGCGCCCTCGACCACGCCTTTGGCCGCGGGCCTGGAGCTCCTGGCAGCACAGCTGACCCGCTTGCGGCCCTCGGCGTCCCGGACGCGGGGCGCGCTGCAGGCGCTGCTCTGGGGGCCCGGGCCTGAGCTGCGCGGCCGCGGAGCACCGCTTGGTCCCTGGCTCCGAGCGCTCGGGCCCTGGCTGCGGGTGCGCCGCGGGCTGCTGGTCCTGCGCCTAGCAGAGCGGGCCGCAGGTGGGGAAGCTCCCAGCCTCGAGGACTGGCTGTGTTGCGAATACCTGGCCGAGGCCACCGAGTCCTCGATGGGCCAGGCCCTGGCGCTGCTGTGGGACTGAgaattc
Amino Acid Sequence: 
MYPYDVPDYAGSMSSPEPPTEPPEPDNPTWSTQPTYSNLGQIRAHLLPSKACRLRAPGALAANPEPLPPPLPKKILTRTQSLPTRRTLHPSSIQVQPPRR PFLGSHSVDKSQAAVGPACLPAELTFGPADAPLGLSLRDLHSPEAVHTALAARQLQGLRTIYARLRARLMGGHPGPCHPGHSFRLLDSSPCAESGDALYY RVVRAHEDAWHILVAKVPKPGADVPHPWGLELQASLSPHFNLQGLCGLVPEGTLPGAPWRGAVALAAEVPERTVAQWLAEACTQPPEEFVWAVALLLLQL SAALKFLEAWGAALVELRPENLLLVAPRGCATTGPPRLLLTDFGRVCLQPPGPPGSPGPHAPQLGSLLRALLSLAAPSTTPLAAGLELLAAQLTRLRPSA SRTRGALQALLWGPGPELRGRGAPLGPWLRALGPWLRVRRGLLVLRLAERAAGGEAPSLEDWLCCEYLAEATESSMGQALALLWD*
Price: £125.00
Completion Time: 
35
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811390.R10
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No

ZNF592

cDNA Synonyms: 
CAMOS; SCAR5
DU Number: 
DU67253
Plasmid: 
pBabeD puro GFP ZNF592
Expressed: 
GFP-ZNF592
Genbank: 
NM_014630.2 with benign SNP S926N and one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGGGGGATATGAAAACCCCAGATTTTGATGACCTTCTGGCTGCCTTTGACATCCCAGACCCCACCAGCCTTGATGCCAAGGAGGCCATCCAGACACCCAGTGAGGAGAATGAGAGTCCCCTCAAACCTCCAGGCATATGTATGGATGAAAGTGTGTCCTTGTCTCACTCAGGATCAGCCCCCGATGTGCCGGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAGGAGTCATTTGAAGCGGAGAAAGACCACATTACTCCCAGTCTCCTACACAATGGATTCCGGGGCTCAGATCTGCCTCCAGATCCCCACAACTGTGGGAAATTTGATTCTACTTTTATGAATGGAGACAGTGCCAGGAGTTTCCCTGGCAAACTGGAGCCTCCCAAGTCAGAGCCATTACCCACCTTCAACCAGTTCAGTCCAATCTCCAGCCCAGAACCTGAGGATCCCATCAAAGATAACGGATTTGGGATAAAGCCCAAACACTCTGACAGTTATTTCCCACCCCCTCTTGGGTGCGGGGCTGTGGGAGGCCCAGTCCTGGAGGCTCTGGCTAAGTTTCCGGTTCCAGAGCTGCATATGTTTGATCATTTTTGTAAGAAAGAACCCAAGCCAGAACCCCTGCCCTTGGGGAGCCAGCAGGAACACGAGCAAAGTGGGCAGAACACAGTGGAACCTCACAAGGATCCGGATGCCACTCGATTCTTCGGGGAAGCTTTGGAGTTCAACAGCCATCCTAGCAACAGTATTGGAGAGTCCAAGGGGCTTGCCCGGGAGCTTGGTACCTGCTCATCAGTCCCCCCTAGGCAGCGTCTAAAGCCAGCTCATTCCAAGCTGTCCTCTTGTGTGGCAGCCTTGGTGGCCTTGCAGGCCAAAAGAGTGGCTAGTGTCACTAAGGAGGATCAGCCTGGCCACACAAAGGATCTCTCAGGGCCCACTAAAGAGAGTTCTAAAGGTAGCCCCAAAATGCCCAAGTCACCAAAGAGTCCCCGGAGCCCTCTGGAGGCCACTAGAAAAAGTATCAAGCCATCGGACAGCCCTCGTAGCATCTGCAGTGACAGCAGCAGCAAAGGCTCACCGTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTGAGAATCAAAACCATTAAGACATCATCAGGGGAAATCAAACGGACTGTCACAAGGATCCTGCCAGATCCTGATGATCCAAGTAAGTCCCCTGTTGGGTCACCTCTAGGGAGCGCCATTGCAGAGGCCCCCAGCGAGATGCCAGGGGATGAGGTGCCTGTGGAAGAGCACTTTCCTGAGGCAGGCACAAATTCAGGGAGCCCCCAGGGGGCCAGGAAAGGGGACGAGAGCATGACAAAGGCCAGTGACTCGTCATCTCCCAGCTGCAGTTCTGGGCCCCGGGTCCCAAAGGGGGCTGCCCCAGGCTCACAGACAGGCAAGAAGCAACAGAGCACAGCACTGCAGGCATCCACCCTGGCCCCTGCCAACCTCCTGCCCAAAGCCGTGCACTTGGCCAACCTGAACCTCGTCCCCCACAGTGTTGCTGCATCAGTGACAGCCAAGTCTTCAGTGCAAAGACGGAGCCAGCCACAGCTTACACAAATGTCGGTGCCCCTGGTCCACCAGGTGAAAAAGGCTGCCCCACTGATTGTAGAGGTCTTCAACAAGGTCCTTCACAGCTCCAACCCCGTGCCCCTCTATGCGCCAAATCTCAGCCCGCCTGCGGACAGCAGGATCCACGTGCCGGCCAGTGGGTACTGCTGCCTGGAGTGTGGAGACGCATTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATGGCCGGCGGAGCGTCCACATTGAGGTACTGTGCACACTGTGCTCCAAGACGCTGCTCTTCTTCAACAAGTGCAGCCTGCTCCGGCACGCCCGTGACCACAAGAGCAAGGGGCTCGTCATGCAGTGTTCCCAGCTGCTGGTGAAGCCTATCTCTGCGGACCAAATGTTCGTGTCGGCCCCTGTGAACTCCACGGCACCAGCAGCCCCAGCCCCTTCATCCTCTCCCAAACATGGCCTCACTTCGGGCAGTGCCAGTCCCCCTCCTCCAGCCTTGCCACTCTACCCAGACCCTGTGAGGCTCATCCGGTACTCAATCAAGTGTCTTGAATGTCACAAGCAGATGCGGGACTACATGGTCCTGGCTGCACATTTCCAGAGGACAACAGAGGAGACAGAGGGGCTGACCTGCCAGGTATGCCAGATGCTGCTGCCCAACCAGTGCAGTTTCTGTGCCCACCAGCGGATTCATGCACACAAGTCCCCCTACTGCTGCCCGGAGTGTGGGGTCCTCTGCCGCTCTGCCTACTTCCAGACCCATGTAAAGGAGAATTGCCTGCACTATGCCCGCAAGGTGGGCTACAGGTGCATCCACTGTGGTGTCGTCCACCTGACCTTGGCCTTGCTGAAAAGCCACATCCAGGAGCGACACTGCCAGGTTTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTGCCAGCAGCACTGCAGACCACAGTGCCACCCAGCACCCCACCCAGCCCCACAGACCCTCCCAGCTCATTTATAAGTGCTCCTGTGAAATGGTCTTCAACAAGAAGAGGCACATTCAGCAGCATTTTTACCAGAATGTCAGCAAGACGCAGGTGGGCGTCTTCAAGTGCCCTGAGTGCCCACTCTTGTTCGTGCAGAAGCCGGAGTTGATGCAACACGTCAAGAGCACCCACGGTGTTCCCCGAAATGTGGACGAGCTGTCAAACCTCCAGTCTTCAGCGGACACATCCTCAAGCCGCCCTGGCTCTCGAGTTCCCACTGAGCCACCAGCCACTAGTGTGGCTGCTCGGAGCAGCTCCCTGCCTTCTGGCCGCTGGGGTAGGCCTGAAGCCCACCGCAGGGTGGAAGCCAGGCCGCGGCTGAGGAACACTGGCTGGACCTGCCAGGAGTGCCAGGAGTGGGTTCCAGATCGGGAGAGCTACGTGTCCCACATGAAAAAGAGCCACGGTCGGACATTGAAGCGGTACCCATGCCGGCAGTGTGAACAGTCCTTCCACACCCCCAACAGCCTGCGCAAACACATCCGCAACAACCATGACACAGTAAAGAAGTTCTACACCTGCGGGTACTGCACAGAGGACAGCCCCAGCTTTCCTCGGCCCTCCCTTCTGGAGAGCCACATCAGCCTTATGCATGGCATCAGAAACCCTGATTTGAGCCAGACGTCCAAAGTGAAACCTCCGGGTGGACATTCCCCTCAGGTGAACCATCTGAAAAGACCAGTCAGTGGAGTGGGGGACGCTCCAGGCACCAGCAATGGCGCAACTGTCTCTTCCACCAAAAGGCACAAGTCCCTTTTTCAGTGCGCGAAATGTAGTTTTGCCACAGACTCGGGGCTCGAGTTTCAGAGCCACATACCTCAGCACCAGGTGGACAGCTCCACAGCCCAATGTCTCCTCTGTGGTTTGTGCTACACCTCTGCCAGCTCCCTCAGCCGCCACCTCTTCATTGTCCACAAGGTGAGAGACCAGGAGGAGGAGGAGGAAGAGGAGGCGGCGGCAGCGGAGATGGCAGTGGAGGTGGCAGAGCCAGAGGAGGGCTCCGGGGAGGAGGTGCCCATGGAGACTAGAGAGAATGGACTGGAAGAATGTGCCGGTGAGCCTTTGTCAGCTGACCCAGAGGCGAGGAGATTGCTGGGCCCGGCCCCTGAGGACGATGGTGGCCACAATGATCACAGTCAACCACAGGCCTCTCAGGACCAGGACAGCCACACACTGTCCCCTCAGGTGTGAGCGGCCGC
Amino Acid Sequence: 
MHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI FFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDN HYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSSEFMGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESV SLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDP IKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEALEFNSHPSNSI GESKGLARELGTCSSVPPRQRLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSI CSDSSSKGSPSVAASSPPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSEMPGDEVPVEEHFPEAGTNSGSPQGARKGDESM TKASDSSSPSCSSGPRVPKGAAPGSQTGKKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPLVHQVKKAAPLIV EVFNKVLHSSNPVPLYAPNLSPPADSRIHVPASGYCCLECGDAFALEKSLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLL VKPISADQMFVSAPVNSTAPAAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQMRDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQ CSFCAHQRIHAHKSPYCCPECGVLCRSAYFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTASSTADHSATQHPT QPHRPSQLIYKCSCEMVFNKKRHIQQHFYQNVSKTQVGVFKCPECPLLFVQKPELMQHVKSTHGVPRNVDELSNLQSSADTSSSRPGSRVPTEPPATSVA ARSSSLPSGRWGRPEAHRRVEARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQSFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDS PSFPRPSLLESHISLMHGIRNPDLSQTSKVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQSHIPQHQVDSST AQCLLCGLCYTSASSLSRHLFIVHKVRDQEEEEEEEAAAAEMAVEVAEPEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQP QASQDQDSHTLSPQV*
Price: £125.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

ZNF592

cDNA Synonyms: 
CAMOS; SCAR5
DU Number: 
DU67251
Plasmid: 
pBabeD puro 3FLAG ZNF592
Expressed: 
3FLAG ZNF592
Genbank: 
NM_014630.2 with benign SNP S926N and one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGGGGGATATGAAAACCCCAGATTTTGATGACCTTCTGGCTGCCTTTGACATCCCAGACCCCACCAGCCTTGATGCCAAGGAGGCCATCCAGACACCCAGTGAGGAGAATGAGAGTCCCCTCAAACCTCCAGGCATATGTATGGATGAAAGTGTGTCCTTGTCTCACTCAGGATCAGCCCCCGATGTGCCGGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAGGAGTCATTTGAAGCGGAGAAAGACCACATTACTCCCAGTCTCCTACACAATGGATTCCGGGGCTCAGATCTGCCTCCAGATCCCCACAACTGTGGGAAATTTGATTCTACTTTTATGAATGGAGACAGTGCCAGGAGTTTCCCTGGCAAACTGGAGCCTCCCAAGTCAGAGCCATTACCCACCTTCAACCAGTTCAGTCCAATCTCCAGCCCAGAACCTGAGGATCCCATCAAAGATAACGGATTTGGGATAAAGCCCAAACACTCTGACAGTTATTTCCCACCCCCTCTTGGGTGCGGGGCTGTGGGAGGCCCAGTCCTGGAGGCTCTGGCTAAGTTTCCGGTTCCAGAGCTGCATATGTTTGATCATTTTTGTAAGAAAGAACCCAAGCCAGAACCCCTGCCCTTGGGGAGCCAGCAGGAACACGAGCAAAGTGGGCAGAACACAGTGGAACCTCACAAGGATCCGGATGCCACTCGATTCTTCGGGGAAGCTTTGGAGTTCAACAGCCATCCTAGCAACAGTATTGGAGAGTCCAAGGGGCTTGCCCGGGAGCTTGGTACCTGCTCATCAGTCCCCCCTAGGCAGCGTCTAAAGCCAGCTCATTCCAAGCTGTCCTCTTGTGTGGCAGCCTTGGTGGCCTTGCAGGCCAAAAGAGTGGCTAGTGTCACTAAGGAGGATCAGCCTGGCCACACAAAGGATCTCTCAGGGCCCACTAAAGAGAGTTCTAAAGGTAGCCCCAAAATGCCCAAGTCACCAAAGAGTCCCCGGAGCCCTCTGGAGGCCACTAGAAAAAGTATCAAGCCATCGGACAGCCCTCGTAGCATCTGCAGTGACAGCAGCAGCAAAGGCTCACCGTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTGAGAATCAAAACCATTAAGACATCATCAGGGGAAATCAAACGGACTGTCACAAGGATCCTGCCAGATCCTGATGATCCAAGTAAGTCCCCTGTTGGGTCACCTCTAGGGAGCGCCATTGCAGAGGCCCCCAGCGAGATGCCAGGGGATGAGGTGCCTGTGGAAGAGCACTTTCCTGAGGCAGGCACAAATTCAGGGAGCCCCCAGGGGGCCAGGAAAGGGGACGAGAGCATGACAAAGGCCAGTGACTCGTCATCTCCCAGCTGCAGTTCTGGGCCCCGGGTCCCAAAGGGGGCTGCCCCAGGCTCACAGACAGGCAAGAAGCAACAGAGCACAGCACTGCAGGCATCCACCCTGGCCCCTGCCAACCTCCTGCCCAAAGCCGTGCACTTGGCCAACCTGAACCTCGTCCCCCACAGTGTTGCTGCATCAGTGACAGCCAAGTCTTCAGTGCAAAGACGGAGCCAGCCACAGCTTACACAAATGTCGGTGCCCCTGGTCCACCAGGTGAAAAAGGCTGCCCCACTGATTGTAGAGGTCTTCAACAAGGTCCTTCACAGCTCCAACCCCGTGCCCCTCTATGCGCCAAATCTCAGCCCGCCTGCGGACAGCAGGATCCACGTGCCGGCCAGTGGGTACTGCTGCCTGGAGTGTGGAGACGCATTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATGGCCGGCGGAGCGTCCACATTGAGGTACTGTGCACACTGTGCTCCAAGACGCTGCTCTTCTTCAACAAGTGCAGCCTGCTCCGGCACGCCCGTGACCACAAGAGCAAGGGGCTCGTCATGCAGTGTTCCCAGCTGCTGGTGAAGCCTATCTCTGCGGACCAAATGTTCGTGTCGGCCCCTGTGAACTCCACGGCACCAGCAGCCCCAGCCCCTTCATCCTCTCCCAAACATGGCCTCACTTCGGGCAGTGCCAGTCCCCCTCCTCCAGCCTTGCCACTCTACCCAGACCCTGTGAGGCTCATCCGGTACTCAATCAAGTGTCTTGAATGTCACAAGCAGATGCGGGACTACATGGTCCTGGCTGCACATTTCCAGAGGACAACAGAGGAGACAGAGGGGCTGACCTGCCAGGTATGCCAGATGCTGCTGCCCAACCAGTGCAGTTTCTGTGCCCACCAGCGGATTCATGCACACAAGTCCCCCTACTGCTGCCCGGAGTGTGGGGTCCTCTGCCGCTCTGCCTACTTCCAGACCCATGTAAAGGAGAATTGCCTGCACTATGCCCGCAAGGTGGGCTACAGGTGCATCCACTGTGGTGTCGTCCACCTGACCTTGGCCTTGCTGAAAAGCCACATCCAGGAGCGACACTGCCAGGTTTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTGCCAGCAGCACTGCAGACCACAGTGCCACCCAGCACCCCACCCAGCCCCACAGACCCTCCCAGCTCATTTATAAGTGCTCCTGTGAAATGGTCTTCAACAAGAAGAGGCACATTCAGCAGCATTTTTACCAGAATGTCAGCAAGACGCAGGTGGGCGTCTTCAAGTGCCCTGAGTGCCCACTCTTGTTCGTGCAGAAGCCGGAGTTGATGCAACACGTCAAGAGCACCCACGGTGTTCCCCGAAATGTGGACGAGCTGTCAAACCTCCAGTCTTCAGCGGACACATCCTCAAGCCGCCCTGGCTCTCGAGTTCCCACTGAGCCACCAGCCACTAGTGTGGCTGCTCGGAGCAGCTCCCTGCCTTCTGGCCGCTGGGGTAGGCCTGAAGCCCACCGCAGGGTGGAAGCCAGGCCGCGGCTGAGGAACACTGGCTGGACCTGCCAGGAGTGCCAGGAGTGGGTTCCAGATCGGGAGAGCTACGTGTCCCACATGAAAAAGAGCCACGGTCGGACATTGAAGCGGTACCCATGCCGGCAGTGTGAACAGTCCTTCCACACCCCCAACAGCCTGCGCAAACACATCCGCAACAACCATGACACAGTAAAGAAGTTCTACACCTGCGGGTACTGCACAGAGGACAGCCCCAGCTTTCCTCGGCCCTCCCTTCTGGAGAGCCACATCAGCCTTATGCATGGCATCAGAAACCCTGATTTGAGCCAGACGTCCAAAGTGAAACCTCCGGGTGGACATTCCCCTCAGGTGAACCATCTGAAAAGACCAGTCAGTGGAGTGGGGGACGCTCCAGGCACCAGCAATGGCGCAACTGTCTCTTCCACCAAAAGGCACAAGTCCCTTTTTCAGTGCGCGAAATGTAGTTTTGCCACAGACTCGGGGCTCGAGTTTCAGAGCCACATACCTCAGCACCAGGTGGACAGCTCCACAGCCCAATGTCTCCTCTGTGGTTTGTGCTACACCTCTGCCAGCTCCCTCAGCCGCCACCTCTTCATTGTCCACAAGGTGAGAGACCAGGAGGAGGAGGAGGAAGAGGAGGCGGCGGCAGCGGAGATGGCAGTGGAGGTGGCAGAGCCAGAGGAGGGCTCCGGGGAGGAGGTGCCCATGGAGACTAGAGAGAATGGACTGGAAGAATGTGCCGGTGAGCCTTTGTCAGCTGACCCAGAGGCGAGGAGATTGCTGGGCCCGGCCCCTGAGGACGATGGTGGCCACAATGATCACAGTCAACCACAGGCCTCTCAGGACCAGGACAGCCACACACTGTCCCCTCAGGTGTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSSEFMGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIVKN TSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPP LGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEALEFNSHPSNSIGESKGLARELGTCSSVPPRQ RLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKGSPSVAASSPPAI PKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSEMPGDEVPVEEHFPEAGTNSGSPQGARKGDESMTKASDSSSPSCSSGPRVPKG AAPGSQTGKKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPLVHQVKKAAPLIVEVFNKVLHSSNPVPLYAPNL SPPADSRIHVPASGYCCLECGDAFALEKSLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLLVKPISADQMFVSAPVNSTAP AAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQMRDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQCSFCAHQRIHAHKSPYCCPE CGVLCRSAYFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTASSTADHSATQHPTQPHRPSQLIYKCSCEMVFNK KRHIQQHFYQNVSKTQVGVFKCPECPLLFVQKPELMQHVKSTHGVPRNVDELSNLQSSADTSSSRPGSRVPTEPPATSVAARSSSLPSGRWGRPEAHRRV EARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQSFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDSPSFPRPSLLESHISLMHGIR NPDLSQTSKVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQSHIPQHQVDSSTAQCLLCGLCYTSASSLSRHL FIVHKVRDQEEEEEEEAAAAEMAVEVAEPEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQPQASQDQDSHTLSPQV*
Price: £125.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

ZNF592

cDNA Synonyms: 
CAMOS; SCAR5
DU Number: 
DU67250
Plasmid: 
pcDNA5 FRT/TO 3FLAG ZNF592
Expressed: 
3FLAG ZNF592
Genbank: 
NM_014630.2 with benign SNP S926N and one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGGGGGATATGAAAACCCCAGATTTTGATGACCTTCTGGCTGCCTTTGACATCCCAGACCCCACCAGCCTTGATGCCAAGGAGGCCATCCAGACACCCAGTGAGGAGAATGAGAGTCCCCTCAAACCTCCAGGCATATGTATGGATGAAAGTGTGTCCTTGTCTCACTCAGGATCAGCCCCCGATGTGCCGGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAGGAGTCATTTGAAGCGGAGAAAGACCACATTACTCCCAGTCTCCTACACAATGGATTCCGGGGCTCAGATCTGCCTCCAGATCCCCACAACTGTGGGAAATTTGATTCTACTTTTATGAATGGAGACAGTGCCAGGAGTTTCCCTGGCAAACTGGAGCCTCCCAAGTCAGAGCCATTACCCACCTTCAACCAGTTCAGTCCAATCTCCAGCCCAGAACCTGAGGATCCCATCAAAGATAACGGATTTGGGATAAAGCCCAAACACTCTGACAGTTATTTCCCACCCCCTCTTGGGTGCGGGGCTGTGGGAGGCCCAGTCCTGGAGGCTCTGGCTAAGTTTCCGGTTCCAGAGCTGCATATGTTTGATCATTTTTGTAAGAAAGAACCCAAGCCAGAACCCCTGCCCTTGGGGAGCCAGCAGGAACACGAGCAAAGTGGGCAGAACACAGTGGAACCTCACAAGGATCCGGATGCCACTCGATTCTTCGGGGAAGCTTTGGAGTTCAACAGCCATCCTAGCAACAGTATTGGAGAGTCCAAGGGGCTTGCCCGGGAGCTTGGTACCTGCTCATCAGTCCCCCCTAGGCAGCGTCTAAAGCCAGCTCATTCCAAGCTGTCCTCTTGTGTGGCAGCCTTGGTGGCCTTGCAGGCCAAAAGAGTGGCTAGTGTCACTAAGGAGGATCAGCCTGGCCACACAAAGGATCTCTCAGGGCCCACTAAAGAGAGTTCTAAAGGTAGCCCCAAAATGCCCAAGTCACCAAAGAGTCCCCGGAGCCCTCTGGAGGCCACTAGAAAAAGTATCAAGCCATCGGACAGCCCTCGTAGCATCTGCAGTGACAGCAGCAGCAAAGGCTCACCGTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTGAGAATCAAAACCATTAAGACATCATCAGGGGAAATCAAACGGACTGTCACAAGGATCCTGCCAGATCCTGATGATCCAAGTAAGTCCCCTGTTGGGTCACCTCTAGGGAGCGCCATTGCAGAGGCCCCCAGCGAGATGCCAGGGGATGAGGTGCCTGTGGAAGAGCACTTTCCTGAGGCAGGCACAAATTCAGGGAGCCCCCAGGGGGCCAGGAAAGGGGACGAGAGCATGACAAAGGCCAGTGACTCGTCATCTCCCAGCTGCAGTTCTGGGCCCCGGGTCCCAAAGGGGGCTGCCCCAGGCTCACAGACAGGCAAGAAGCAACAGAGCACAGCACTGCAGGCATCCACCCTGGCCCCTGCCAACCTCCTGCCCAAAGCCGTGCACTTGGCCAACCTGAACCTCGTCCCCCACAGTGTTGCTGCATCAGTGACAGCCAAGTCTTCAGTGCAAAGACGGAGCCAGCCACAGCTTACACAAATGTCGGTGCCCCTGGTCCACCAGGTGAAAAAGGCTGCCCCACTGATTGTAGAGGTCTTCAACAAGGTCCTTCACAGCTCCAACCCCGTGCCCCTCTATGCGCCAAATCTCAGCCCGCCTGCGGACAGCAGGATCCACGTGCCGGCCAGTGGGTACTGCTGCCTGGAGTGTGGAGACGCATTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATGGCCGGCGGAGCGTCCACATTGAGGTACTGTGCACACTGTGCTCCAAGACGCTGCTCTTCTTCAACAAGTGCAGCCTGCTCCGGCACGCCCGTGACCACAAGAGCAAGGGGCTCGTCATGCAGTGTTCCCAGCTGCTGGTGAAGCCTATCTCTGCGGACCAAATGTTCGTGTCGGCCCCTGTGAACTCCACGGCACCAGCAGCCCCAGCCCCTTCATCCTCTCCCAAACATGGCCTCACTTCGGGCAGTGCCAGTCCCCCTCCTCCAGCCTTGCCACTCTACCCAGACCCTGTGAGGCTCATCCGGTACTCAATCAAGTGTCTTGAATGTCACAAGCAGATGCGGGACTACATGGTCCTGGCTGCACATTTCCAGAGGACAACAGAGGAGACAGAGGGGCTGACCTGCCAGGTATGCCAGATGCTGCTGCCCAACCAGTGCAGTTTCTGTGCCCACCAGCGGATTCATGCACACAAGTCCCCCTACTGCTGCCCGGAGTGTGGGGTCCTCTGCCGCTCTGCCTACTTCCAGACCCATGTAAAGGAGAATTGCCTGCACTATGCCCGCAAGGTGGGCTACAGGTGCATCCACTGTGGTGTCGTCCACCTGACCTTGGCCTTGCTGAAAAGCCACATCCAGGAGCGACACTGCCAGGTTTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTGCCAGCAGCACTGCAGACCACAGTGCCACCCAGCACCCCACCCAGCCCCACAGACCCTCCCAGCTCATTTATAAGTGCTCCTGTGAAATGGTCTTCAACAAGAAGAGGCACATTCAGCAGCATTTTTACCAGAATGTCAGCAAGACGCAGGTGGGCGTCTTCAAGTGCCCTGAGTGCCCACTCTTGTTCGTGCAGAAGCCGGAGTTGATGCAACACGTCAAGAGCACCCACGGTGTTCCCCGAAATGTGGACGAGCTGTCAAACCTCCAGTCTTCAGCGGACACATCCTCAAGCCGCCCTGGCTCTCGAGTTCCCACTGAGCCACCAGCCACTAGTGTGGCTGCTCGGAGCAGCTCCCTGCCTTCTGGCCGCTGGGGTAGGCCTGAAGCCCACCGCAGGGTGGAAGCCAGGCCGCGGCTGAGGAACACTGGCTGGACCTGCCAGGAGTGCCAGGAGTGGGTTCCAGATCGGGAGAGCTACGTGTCCCACATGAAAAAGAGCCACGGTCGGACATTGAAGCGGTACCCATGCCGGCAGTGTGAACAGTCCTTCCACACCCCCAACAGCCTGCGCAAACACATCCGCAACAACCATGACACAGTAAAGAAGTTCTACACCTGCGGGTACTGCACAGAGGACAGCCCCAGCTTTCCTCGGCCCTCCCTTCTGGAGAGCCACATCAGCCTTATGCATGGCATCAGAAACCCTGATTTGAGCCAGACGTCCAAAGTGAAACCTCCGGGTGGACATTCCCCTCAGGTGAACCATCTGAAAAGACCAGTCAGTGGAGTGGGGGACGCTCCAGGCACCAGCAATGGCGCAACTGTCTCTTCCACCAAAAGGCACAAGTCCCTTTTTCAGTGCGCGAAATGTAGTTTTGCCACAGACTCGGGGCTCGAGTTTCAGAGCCACATACCTCAGCACCAGGTGGACAGCTCCACAGCCCAATGTCTCCTCTGTGGTTTGTGCTACACCTCTGCCAGCTCCCTCAGCCGCCACCTCTTCATTGTCCACAAGGTGAGAGACCAGGAGGAGGAGGAGGAAGAGGAGGCGGCGGCAGCGGAGATGGCAGTGGAGGTGGCAGAGCCAGAGGAGGGCTCCGGGGAGGAGGTGCCCATGGAGACTAGAGAGAATGGACTGGAAGAATGTGCCGGTGAGCCTTTGTCAGCTGACCCAGAGGCGAGGAGATTGCTGGGCCCGGCCCCTGAGGACGATGGTGGCCACAATGATCACAGTCAACCACAGGCCTCTCAGGACCAGGACAGCCACACACTGTCCCCTCAGGTGTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSPEFMGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSV IVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSY FPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEALEFNSHPSNSIGESKGLARELGTCSSV PPRQRLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKGSPSVAASS PPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSEMPGDEVPVEEHFPEAGTNSGSPQGARKGDESMTKASDSSSPSCSSGPR VPKGAAPGSQTGKKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPLVHQVKKAAPLIVEVFNKVLHSSNPVPLY APNLSPPADSRIHVPASGYCCLECGDAFALEKSLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLLVKPISADQMFVSAPVN STAPAAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQMRDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQCSFCAHQRIHAHKSPY CCPECGVLCRSAYFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTASSTADHSATQHPTQPHRPSQLIYKCSCEM VFNKKRHIQQHFYQNVSKTQVGVFKCPECPLLFVQKPELMQHVKSTHGVPRNVDELSNLQSSADTSSSRPGSRVPTEPPATSVAARSSSLPSGRWGRPEA HRRVEARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQSFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDSPSFPRPSLLESHISLM HGIRNPDLSQTSKVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQSHIPQHQVDSSTAQCLLCGLCYTSASSL SRHLFIVHKVRDQEEEEEEEAAAAEMAVEVAEPEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQPQASQDQDSHTLSPQV*
Price: £125.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

MPLKIP

cDNA Synonyms: 
TTDN1; ABHS; C7orf11; ORF20; TTD4
DU Number: 
DU67235
Plasmid: 
pcDNA5D FRT/TO GFP MPLKIP
Expressed: 
GFP MPLKIP
Genbank: 
NM_138701.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCAGCGACAGAATTTTCGGCCCCCAACTCCTCCTTACCCTGGTCCGGGTGGAGGAGGTTGGGGTAGCGGAAGCAGCTTCCGGGGAACCCCGGGCGGGGGCGGACCACGGCCGCCCTCCCCTCGAGACGGGTACGGGAGTCCGCACCACACGCCGCCGTACGGGCCCCGGTCTAGGCCGTACGGGAGCAGTCACTCTCCGCGACACGGCGGCAGCTTCCCGGGGGGCCGGTTCGGGTCTCCGTCCCCTGGCGGCTACCCTGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCAGCAATTCGGCTACTCCCCAGGGCAGCAGCAGACCCACCCCCAGGGTTCTCCAAGGACATCTACACCATTTGGATCAGGGCGTGTTAGAGAAAAAAGAATGTCTAATGAGTTGGAAAATTATTTCAAGCCTTCAATGCTTGAAGATCCTTGGGCTGGCCTAGAACCAGTATCTGTAGTGGATATAAGCCAACAATACAGCAATACTCAAACATTCACAGGCAAAAAAGGAAGATACTTTTGTTAAGCGGCCGC
Amino Acid Sequence: 
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGP RSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVS VVDISQQYSNTQTFTGKKGRYFC*
Price: £125.00
Completion Time: 
20
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

MPLKIP

cDNA Synonyms: 
TTDN1; ABHS; C7orf11; ORF20; TTD4
DU Number: 
DU67234
Plasmid: 
pBabeD puro GFP MPLKIP
Expressed: 
GFP MPLKIP
Genbank: 
NM_138701.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCAGCGACAGAATTTTCGGCCCCCAACTCCTCCTTACCCTGGTCCGGGTGGAGGAGGTTGGGGTAGCGGAAGCAGCTTCCGGGGAACCCCGGGCGGGGGCGGACCACGGCCGCCCTCCCCTCGAGACGGGTACGGGAGTCCGCACCACACGCCGCCGTACGGGCCCCGGTCTAGGCCGTACGGGAGCAGTCACTCTCCGCGACACGGCGGCAGCTTCCCGGGGGGCCGGTTCGGGTCTCCGTCCCCTGGCGGCTACCCTGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCAGCAATTCGGCTACTCCCCAGGGCAGCAGCAGACCCACCCCCAGGGTTCTCCAAGGACATCTACACCATTTGGATCAGGGCGTGTTAGAGAAAAAAGAATGTCTAATGAGTTGGAAAATTATTTCAAGCCTTCAATGCTTGAAGATCCTTGGGCTGGCCTAGAACCAGTATCTGTAGTGGATATAAGCCAACAATACAGCAATACTCAAACATTCACAGGCAAAAAAGGAAGATACTTTTGTTAAGCGGCCGC
Amino Acid Sequence: 
MHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI FFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDN HYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYG PRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPV SVVDISQQYSNTQTFTGKKGRYFC*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

MPLKIP

cDNA Synonyms: 
TTDN1; ABHS; C7orf11; ORF20; TTD4
DU Number: 
DU67233
Plasmid: 
pBabeD puro 3FLAG MPLKIP
Expressed: 
3FLAG MPLKIP
Genbank: 
NM_138701.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCAGCGACAGAATTTTCGGCCCCCAACTCCTCCTTACCCTGGTCCGGGTGGAGGAGGTTGGGGTAGCGGAAGCAGCTTCCGGGGAACCCCGGGCGGGGGCGGACCACGGCCGCCCTCCCCTCGAGACGGGTACGGGAGTCCGCACCACACGCCGCCGTACGGGCCCCGGTCTAGGCCGTACGGGAGCAGTCACTCTCCGCGACACGGCGGCAGCTTCCCGGGGGGCCGGTTCGGGTCTCCGTCCCCTGGCGGCTACCCTGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCAGCAATTCGGCTACTCCCCAGGGCAGCAGCAGACCCACCCCCAGGGTTCTCCAAGGACATCTACACCATTTGGATCAGGGCGTGTTAGAGAAAAAAGAATGTCTAATGAGTTGGAAAATTATTTCAAGCCTTCAATGCTTGAAGATCCTTGGGCTGGCCTAGAACCAGTATCTGTAGTGGATATAAGCCAACAATACAGCAATACTCAAACATTCACAGGCAAAAAAGGAAGATACTTTTGTTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPG GRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKG RYFC*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

MPLKIP

cDNA Synonyms: 
TTDN1; ABHS; C7orf11; ORF20; TTD4
DU Number: 
DU67232
Plasmid: 
pcDNA5 FRT/TO 3FLAG MPLKIP
Expressed: 
3FLAG MPLKIP
Genbank: 
NM_138701.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCAGCGACAGAATTTTCGGCCCCCAACTCCTCCTTACCCTGGTCCGGGTGGAGGAGGTTGGGGTAGCGGAAGCAGCTTCCGGGGAACCCCGGGCGGGGGCGGACCACGGCCGCCCTCCCCTCGAGACGGGTACGGGAGTCCGCACCACACGCCGCCGTACGGGCCCCGGTCTAGGCCGTACGGGAGCAGTCACTCTCCGCGACACGGCGGCAGCTTCCCGGGGGGCCGGTTCGGGTCTCCGTCCCCTGGCGGCTACCCTGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCAGCAATTCGGCTACTCCCCAGGGCAGCAGCAGACCCACCCCCAGGGTTCTCCAAGGACATCTACACCATTTGGATCAGGGCGTGTTAGAGAAAAAAGAATGTCTAATGAGTTGGAAAATTATTTCAAGCCTTCAATGCTTGAAGATCCTTGGGCTGGCCTAGAACCAGTATCTGTAGTGGATATAAGCCAACAATACAGCAATACTCAAACATTCACAGGCAAAAAAGGAAGATACTTTTGTTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGG SFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFT GKKGRYFC*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
PMID: 
rouse-CDKL5-paper-3

ZNF592

cDNA Synonyms: 
CAMOS; SCAR5
DU Number: 
DU67237
Plasmid: 
pcDNA5D FRT/TO GFP ZNF592
Expressed: 
GFP-ZNF592
Genbank: 
NM_014630.2 with benign SNP S926N and one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGGGGGATATGAAAACCCCAGATTTTGATGACCTTCTGGCTGCCTTTGACATCCCAGACCCCACCAGCCTTGATGCCAAGGAGGCCATCCAGACACCCAGTGAGGAGAATGAGAGTCCCCTCAAACCTCCAGGCATATGTATGGATGAAAGTGTGTCCTTGTCTCACTCAGGATCAGCCCCCGATGTGCCGGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAGGAGTCATTTGAAGCGGAGAAAGACCACATTACTCCCAGTCTCCTACACAATGGATTCCGGGGCTCAGATCTGCCTCCAGATCCCCACAACTGTGGGAAATTTGATTCTACTTTTATGAATGGAGACAGTGCCAGGAGTTTCCCTGGCAAACTGGAGCCTCCCAAGTCAGAGCCATTACCCACCTTCAACCAGTTCAGTCCAATCTCCAGCCCAGAACCTGAGGATCCCATCAAAGATAACGGATTTGGGATAAAGCCCAAACACTCTGACAGTTATTTCCCACCCCCTCTTGGGTGCGGGGCTGTGGGAGGCCCAGTCCTGGAGGCTCTGGCTAAGTTTCCGGTTCCAGAGCTGCATATGTTTGATCATTTTTGTAAGAAAGAACCCAAGCCAGAACCCCTGCCCTTGGGGAGCCAGCAGGAACACGAGCAAAGTGGGCAGAACACAGTGGAACCTCACAAGGATCCGGATGCCACTCGATTCTTCGGGGAAGCTTTGGAGTTCAACAGCCATCCTAGCAACAGTATTGGAGAGTCCAAGGGGCTTGCCCGGGAGCTTGGTACCTGCTCATCAGTCCCCCCTAGGCAGCGTCTAAAGCCAGCTCATTCCAAGCTGTCCTCTTGTGTGGCAGCCTTGGTGGCCTTGCAGGCCAAAAGAGTGGCTAGTGTCACTAAGGAGGATCAGCCTGGCCACACAAAGGATCTCTCAGGGCCCACTAAAGAGAGTTCTAAAGGTAGCCCCAAAATGCCCAAGTCACCAAAGAGTCCCCGGAGCCCTCTGGAGGCCACTAGAAAAAGTATCAAGCCATCGGACAGCCCTCGTAGCATCTGCAGTGACAGCAGCAGCAAAGGCTCACCGTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTGAGAATCAAAACCATTAAGACATCATCAGGGGAAATCAAACGGACTGTCACAAGGATCCTGCCAGATCCTGATGATCCAAGTAAGTCCCCTGTTGGGTCACCTCTAGGGAGCGCCATTGCAGAGGCCCCCAGCGAGATGCCAGGGGATGAGGTGCCTGTGGAAGAGCACTTTCCTGAGGCAGGCACAAATTCAGGGAGCCCCCAGGGGGCCAGGAAAGGGGACGAGAGCATGACAAAGGCCAGTGACTCGTCATCTCCCAGCTGCAGTTCTGGGCCCCGGGTCCCAAAGGGGGCTGCCCCAGGCTCACAGACAGGCAAGAAGCAACAGAGCACAGCACTGCAGGCATCCACCCTGGCCCCTGCCAACCTCCTGCCCAAAGCCGTGCACTTGGCCAACCTGAACCTCGTCCCCCACAGTGTTGCTGCATCAGTGACAGCCAAGTCTTCAGTGCAAAGACGGAGCCAGCCACAGCTTACACAAATGTCGGTGCCCCTGGTCCACCAGGTGAAAAAGGCTGCCCCACTGATTGTAGAGGTCTTCAACAAGGTCCTTCACAGCTCCAACCCCGTGCCCCTCTATGCGCCAAATCTCAGCCCGCCTGCGGACAGCAGGATCCACGTGCCGGCCAGTGGGTACTGCTGCCTGGAGTGTGGAGACGCATTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATGGCCGGCGGAGCGTCCACATTGAGGTACTGTGCACACTGTGCTCCAAGACGCTGCTCTTCTTCAACAAGTGCAGCCTGCTCCGGCACGCCCGTGACCACAAGAGCAAGGGGCTCGTCATGCAGTGTTCCCAGCTGCTGGTGAAGCCTATCTCTGCGGACCAAATGTTCGTGTCGGCCCCTGTGAACTCCACGGCACCAGCAGCCCCAGCCCCTTCATCCTCTCCCAAACATGGCCTCACTTCGGGCAGTGCCAGTCCCCCTCCTCCAGCCTTGCCACTCTACCCAGACCCTGTGAGGCTCATCCGGTACTCAATCAAGTGTCTTGAATGTCACAAGCAGATGCGGGACTACATGGTCCTGGCTGCACATTTCCAGAGGACAACAGAGGAGACAGAGGGGCTGACCTGCCAGGTATGCCAGATGCTGCTGCCCAACCAGTGCAGTTTCTGTGCCCACCAGCGGATTCATGCACACAAGTCCCCCTACTGCTGCCCGGAGTGTGGGGTCCTCTGCCGCTCTGCCTACTTCCAGACCCATGTAAAGGAGAATTGCCTGCACTATGCCCGCAAGGTGGGCTACAGGTGCATCCACTGTGGTGTCGTCCACCTGACCTTGGCCTTGCTGAAAAGCCACATCCAGGAGCGACACTGCCAGGTTTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTGCCAGCAGCACTGCAGACCACAGTGCCACCCAGCACCCCACCCAGCCCCACAGACCCTCCCAGCTCATTTATAAGTGCTCCTGTGAAATGGTCTTCAACAAGAAGAGGCACATTCAGCAGCATTTTTACCAGAATGTCAGCAAGACGCAGGTGGGCGTCTTCAAGTGCCCTGAGTGCCCACTCTTGTTCGTGCAGAAGCCGGAGTTGATGCAACACGTCAAGAGCACCCACGGTGTTCCCCGAAATGTGGACGAGCTGTCAAACCTCCAGTCTTCAGCGGACACATCCTCAAGCCGCCCTGGCTCTCGAGTTCCCACTGAGCCACCAGCCACTAGTGTGGCTGCTCGGAGCAGCTCCCTGCCTTCTGGCCGCTGGGGTAGGCCTGAAGCCCACCGCAGGGTGGAAGCCAGGCCGCGGCTGAGGAACACTGGCTGGACCTGCCAGGAGTGCCAGGAGTGGGTTCCAGATCGGGAGAGCTACGTGTCCCACATGAAAAAGAGCCACGGTCGGACATTGAAGCGGTACCCATGCCGGCAGTGTGAACAGTCCTTCCACACCCCCAACAGCCTGCGCAAACACATCCGCAACAACCATGACACAGTAAAGAAGTTCTACACCTGCGGGTACTGCACAGAGGACAGCCCCAGCTTTCCTCGGCCCTCCCTTCTGGAGAGCCACATCAGCCTTATGCATGGCATCAGAAACCCTGATTTGAGCCAGACGTCCAAAGTGAAACCTCCGGGTGGACATTCCCCTCAGGTGAACCATCTGAAAAGACCAGTCAGTGGAGTGGGGGACGCTCCAGGCACCAGCAATGGCGCAACTGTCTCTTCCACCAAAAGGCACAAGTCCCTTTTTCAGTGCGCGAAATGTAGTTTTGCCACAGACTCGGGGCTCGAGTTTCAGAGCCACATACCTCAGCACCAGGTGGACAGCTCCACAGCCCAATGTCTCCTCTGTGGTTTGTGCTACACCTCTGCCAGCTCCCTCAGCCGCCACCTCTTCATTGTCCACAAGGTGAGAGACCAGGAGGAGGAGGAGGAAGAGGAGGCGGCGGCAGCGGAGATGGCAGTGGAGGTGGCAGAGCCAGAGGAGGGCTCCGGGGAGGAGGTGCCCATGGAGACTAGAGAGAATGGACTGGAAGAATGTGCCGGTGAGCCTTTGTCAGCTGACCCAGAGGCGAGGAGATTGCTGGGCCCGGCCCCTGAGGACGATGGTGGCCACAATGATCACAGTCAACCACAGGCCTCTCAGGACCAGGACAGCCACACACTGTCCCCTCAGGTGTGAGCGGCCGC
Amino Acid Sequence: 
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSPGEFMGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESV SLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDP IKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEALEFNSHPSNSI GESKGLARELGTCSSVPPRQRLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSI CSDSSSKGSPSVAASSPPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSEMPGDEVPVEEHFPEAGTNSGSPQGARKGDESM TKASDSSSPSCSSGPRVPKGAAPGSQTGKKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPLVHQVKKAAPLIV EVFNKVLHSSNPVPLYAPNLSPPADSRIHVPASGYCCLECGDAFALEKSLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLL VKPISADQMFVSAPVNSTAPAAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQMRDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQ CSFCAHQRIHAHKSPYCCPECGVLCRSAYFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTASSTADHSATQHPT QPHRPSQLIYKCSCEMVFNKKRHIQQHFYQNVSKTQVGVFKCPECPLLFVQKPELMQHVKSTHGVPRNVDELSNLQSSADTSSSRPGSRVPTEPPATSVA ARSSSLPSGRWGRPEAHRRVEARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQSFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDS PSFPRPSLLESHISLMHGIRNPDLSQTSKVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQSHIPQHQVDSST AQCLLCGLCYTSASSLSRHLFIVHKVRDQEEEEEEEAAAAEMAVEVAEPEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQP QASQDQDSHTLSPQV*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
PMID: 
rouse-CDKL5-paper-3

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.