Kinase

Srpk2 (mouse)

cDNA Synonyms: 
Wbp6; mSRPK2; AW226533; AW492537; AW547358
DU Number: 
DU61764
Plasmid: 
pCAGGS puro 3FLAG mouse Srpk2 (internal BamH1 killed)
Expressed: 
3FLAG mouse Srpk2 (internal BamH1 killed)
Genbank: 
GI: 20817, NP_033300.2 with delta Q314 - common variant, and some silent changes
Species: 
Mouse
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSPEFNSSMSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPLPDPAPPEPEEEILGSDDEEQEDPADYCKGGYHPV KIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGH HLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKK LKKKQKRQAELLEKRLQEIEELEREAERKILEENITSAEASGEQDGEYQPEVTLKAADLEDTTEEETAKDNGEVEDQEEKEDAEKENAEKDEDDVEQELA NLDPTWVESPKANGHIENGPFSLEQQLEDEEDDEDDCANPEEYNLDEPNAESDYTYSSSYEQFNGELPNGQHKTSEFPTPLFSGPLEPVACGSVISEGSP LTEQEESSPSHDRSRTVSASSTGDLPKTKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFE LATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRAS AGECLRHPWLNS*
Price: £125.00
Completion Time: 
0
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

WNK2 (1 - 627)

Catalog Number (DU Number): 
DU49486
Protein Activity: 
Expression: 
Purification Method: 
GSH Agarose
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Monday, 18 October, 2021 - 16
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

PLK4 (1 - 269)

Long Name: 
Polo Like Kinase 4
Accession: 
NM_014264.2
Catalog Number (DU Number): 
DU62994
Protein Activity: 
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
57, 562.27 daltons
Average Mass: 
57, 599.85 daltons
Theoretical PI: 
6.71
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-80 deg C
Assay Substrate: 
Myelin Basic Protein Final concentration: 1 mg/ml
Native Sequence: 
Amino acids M1 – S269 (end residue is H970) of human PLK4. Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 sites of pGEX6P-1
Target Family: 
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Tuesday, 21 November, 2017 - 11
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

PLK4 (1 - 970)

Long Name: 
Polo Like Kinase 4
Accession: 
NM_014264.2
Catalog Number (DU Number): 
DU43937
Protein Activity: 
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
135, 710.02 daltons
Average Mass: 
135, 796.11 daltons
Theoretical PI: 
8.35
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-80 deg C
Assay Substrate: 
Myelin Basic Protein Final concentration: 1 mg/ml
Native Sequence: 
Amino acids M1 – H970 (end residue) of human PLK4. Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 sites of pGEX6P-1
Target Family: 
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Tuesday, 21 November, 2017 - 11
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

PLK1 (37 - 338)

Long Name: 
Polo Like Kinase 1
Accession: 
NM_005030.6
Catalog Number (DU Number): 
DU61680
Protein Activity: 
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
61, 361.92 daltons
Average Mass: 
61, 401.41 daltons
Theoretical PI: 
8.54
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-80 deg C
Assay Substrate: 
ISDELMDATFADQEAKKK
Native Sequence: 
Amino acids P37 – N338 (end residue is S603) of human PLK1. Residue P232 of the fusion protein is equivalent to P37 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 sites of pGEX6P-1
Target Family: 
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Tuesday, 21 November, 2017 - 11
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

AAK1 (1 - 365)

Long Name: 
AP2 associated kinase 1
Accession: 
NM_014911.5
Catalog Number (DU Number): 
DU61573
Protein Activity: 
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
67, 338.03 daltons
Average Mass: 
67, 381.63 daltons
Theoretical PI: 
6.39
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-80 deg C
Assay Buffer: 
50 mM Tris-HCl pH 7.5, 0.1mM EGTA, 10 mM DTT, 10 mM MgAc
Assay Substrate: 
Myelin Basic Protein Final concentration: 1 mg/ml
Native Sequence: 
Amino acids M1 – A365 (end residue is L961) of human AAK1. Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 and Not1 sites of pFastBac-GST
Target Family: 
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Friday, 31 May, 2019 - 15
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

TYRO3 (468 - 890)

Long Name: 
TYRO3 protein tyrosine kinase
Accession: 
NM_006293.4
Catalog Number (DU Number): 
DU61217
Protein Activity: 
Expression: 
Purification Method: 
GSH Sepharose
Mono-Isotopic Mass: 
73, 802.14 daltons
Average Mass: 
73, 850.01 daltons
Theoretical PI: 
5.40
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM sucrose, 150 mM NaCl, 0.1 mM EGTA, 10 mM DTT, 0.02 % Brij-35, 0.2 mM PMSF, 1 mM Benzamidine.
Storage Temperature: 
-70 °C
Assay Buffer: 
50 mM Tris-HCl pH 7.5, 0.1mM EGTA, 10 mM DTT, 10 mM MgAc
Assay Substrate: 
Poly Glu Tyr (4:1) Final concentration: 0.1 mg/ml
Native Sequence: 
Amino acids M468 – C890 (end) of human TYRO3. Residue M232 of the fusion protein is equivalent to M468 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission site (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 and Not1 sites of pFastBac GST 6P1
Target Family: 
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Friday, 24 September, 2021 - 09
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

MET (1051 - 1349)

Long Name: 
MET proto-oncogene, receptor tyrosine kinase
Accession: 
NM_000245.4
Catalog Number (DU Number): 
DU61348
Protein Activity: 
Expression: 
Purification Method: 
GSH Sepharose
Mono-Isotopic Mass: 
60, 683.10 daltons
Average Mass: 
60, 722.54 daltons
Theoretical PI: 
6.68
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM sucrose, 150 mM NaCl, 0.1 mM EGTA, 10 mM DTT, 0.02 % Brij-35, 0.2 mM PMSF, 1 mM Benzamidine.
Storage Temperature: 
-70 °C
Assay Buffer: 
50 mM Tris-HCl pH 7.5, 0.1mM EGTA, 10 mM DTT, 10 mM MgAc
Assay Substrate: 
GGMEDIYFEFMGGKKK Final concentration: 300 uM
Native Sequence: 
Amino acids V1051– Y1390 (end) of human MET. Residue V232 of the fusion protein is equivalent to V1051 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission site (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 and Not1 sites of pFastBac GST 6P1
Target Family: 
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Thursday, 23 September, 2021 - 14
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

NEK1

cDNA Synonyms: 
NY-REN-55; SRPS2; SRPS2A; SRTD6
DU Number: 
DU70630
Cost of Production: 
200.00
Plasmid: 
pcDNA5D FRT/TO 3NLS NEK1 D146A NLS
Expressed: 
3NLS NEK1 D146A NLS
Genbank: 
NM_001199397.1 with one silent change
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MPKKKRKVPKKKRKVPKKKRKVMEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYI VMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGAFGIARVLNSTVELARTCIGTPYYLSPEICENK PYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQLIAEEFCLK TFSKFGSQPIPAKRPASGQNSISVMPAQKITKPAAKYGIPLAYKKYGDKKLHEKKPLQKHKQAHQTPEKRVNTGEERRKISEEAARKRRLEFIEKEKKQK DQIISLMKAEQMKRQEKERLERINRAREQGWRNVLSAGGSGEVKAPFLGSGGTIAPSSFSSRGQYEHYHAIFDQMQQQRAEDNEAKWKREIYGRGLPERG ILPGVRPGFPYGAAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQVEEFLQRKREAMQNKARAEGHMGILQNLAAMYGGRPSSSRGGKPR NKEEEVYLARLRQIRLQNFNERQQIKAKLRGEKKEANHSEGQEGSEEADMRRKKIESLKAHANARAAVLKEQLERKRKEAYEREKKVWEEHLVAKGVKSS DVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKE KSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKYKPLITGE KKVQCISHEINPSAIVDSPVETKSPEFSEASPQMSLKLEGNLEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRITIQENEVSEDG VSSTVDQLSDIHIEPGTNDSQHSKCDVDKSVQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSHLPPKNKNKNSLLIGLSTGLFDANNPKMLRT CSLPDLSKLFRTLMDVPTVGDVRQDNLEIDEIEDENIKEGPSDSEDIVFEETDTDLQELQASMEQLLREQPGEEYSEEEESVLKNSDVEPTANGTDVADE DDNPSSESALNEEWHSDNSDGEIASECECDSVFNHLEELRLHLEQEMGFEKFFEVYEKIKAIHEDEDENIEICSKIVQNILGNEHQHLYAKILHLVMADG AYQEDNDEPPKKKRKV*
Price: £125.00
Completion Time: 
29
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
Yes
Hidden Project: 
No
Cost Centre: 
357.811395.R106
Pass to production: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

NEK1

cDNA Synonyms: 
NY-REN-55; SRPS2; SRPS2A; SRTD6
DU Number: 
DU70629
Cost of Production: 
200.00
Plasmid: 
pcDNA5D FRT/TO 3NLS NEK1 NLS
Expressed: 
3NLS NEK1 - NLS
Genbank: 
NM_001199397.1 with one silent change
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MPKKKRKVPKKKRKVPKKKRKVMEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYI VMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENK PYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQLIAEEFCLK TFSKFGSQPIPAKRPASGQNSISVMPAQKITKPAAKYGIPLAYKKYGDKKLHEKKPLQKHKQAHQTPEKRVNTGEERRKISEEAARKRRLEFIEKEKKQK DQIISLMKAEQMKRQEKERLERINRAREQGWRNVLSAGGSGEVKAPFLGSGGTIAPSSFSSRGQYEHYHAIFDQMQQQRAEDNEAKWKREIYGRGLPERG ILPGVRPGFPYGAAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQVEEFLQRKREAMQNKARAEGHMGILQNLAAMYGGRPSSSRGGKPR NKEEEVYLARLRQIRLQNFNERQQIKAKLRGEKKEANHSEGQEGSEEADMRRKKIESLKAHANARAAVLKEQLERKRKEAYEREKKVWEEHLVAKGVKSS DVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKE KSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKYKPLITGE KKVQCISHEINPSAIVDSPVETKSPEFSEASPQMSLKLEGNLEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRITIQENEVSEDG VSSTVDQLSDIHIEPGTNDSQHSKCDVDKSVQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSHLPPKNKNKNSLLIGLSTGLFDANNPKMLRT CSLPDLSKLFRTLMDVPTVGDVRQDNLEIDEIEDENIKEGPSDSEDIVFEETDTDLQELQASMEQLLREQPGEEYSEEEESVLKNSDVEPTANGTDVADE DDNPSSESALNEEWHSDNSDGEIASECECDSVFNHLEELRLHLEQEMGFEKFFEVYEKIKAIHEDEDENIEICSKIVQNILGNEHQHLYAKILHLVMADG AYQEDNDEPPKKKRKV*
Price: £125.00
Completion Time: 
29
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
Yes
Hidden Project: 
No
Cost Centre: 
357.811395.R106
Pass to production: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.