3FLAG

TLE1 tv x4

cDNA Synonyms: 
ESG; ESG1; GRG1
DU Number: 
DU63918
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS TLE1 tv x4
Expressed: 
3FLAG GSGSGS NLS TLE1 tv x4
Genbank: 
XM_005252153.1 with 2 silent changes and delta A389
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGTTCCCGCAGAGCCGGCACCCGACGCCGCACCAGGCTGCAGGCCAGCCCTTCAAGTTCACTATCCCGGAGTCCCTGGACCGGATTAAAGAGGAATTCCAGTTCCTGCAGGCGCAGTATCACAGCCTTAAATTGGAATGTGAGAAACTGGCAAGTGAAAAGACAGAAATGCAGAGGCACTATGTGATGTATTATGAAATGTCATATGGATTAAACATTGAAATGCACAAACAGACTGAAATCGCCAAGAGATTGAATACGATTTGTGCACAAGTCATCCCATTTCTGTCTCAGGAACATCAACAACAGGTGGCCCAGGCTGTTGAACGTGCCAAACAGGTGACCATGGCAGAGTTGAATGCCATCATCGGGCAGCAGCAGTTGCAAGCTCAGCATCTTTCTCATGGCCACGGACCCCCAGTTCCCCTTACGCCTCACCCTTCGGGACTTCAGCCTCCTGGAATCCCGCCCCTCGGGGGCAGTGCCGGCCTTCTTGCGCTGTCTAGTGCTCTGAGTGGGCAGTCTCACTTGGCAATAAAAGATGACAAGAAGCACCACGATGCAGAGCACCACAGAGACAGAGAGCCGGGCACAAGTAATTCCCTCCTGGTCCCAGACAGTCTAAGAGGCACAGATAAACGCAGAAATGGACCTGAATTTTCCAATGACATCAAGAAAAGGAAGGTGGATGATAAGGACTCCAGCCACTATGACAGTGATGGTGACAAAAGCGATGACAACTTAGTTGTGGATGTGTCTAATGAGGACCCTTCTTCTCCGCGAGCAAGCCCTGCCCACTCGCCCCGGGAAAATGGAATCGACAAAAATCGCCTGCTAAAGAAGGATGCTTCTAGCAGTCCAGCTTCCACGGCCTCCTCGGCAAGTTCCACTTCTTTGAAATCCAAAGAAATGAGCTTGCATGAAAAAGCCAGCACGCCTGTTCTGAAATCCAGCACACCAACGCCTCGGAGCGACATGCCAACGCCGGGCACCAGCGCCACTCCAGGCCTCCGTCCAGGTCTCGGCAAGCCTCCAGCCATAGACCCCCTCGTTAACCAAGCGGGATTGGATTTTCATTTGGAATTGGTACCGGGGAATGGAAAGTTCGGACTGAAAGAGAAATCTTGGATTTTATCGAGAAAATCTTCTTTTGAGATTAAGTCAGCTGGCTTGAGGACACCCCTGGCAGTGCCCGGCCCATATCCTGCTCCTTTTGGGATGGTCCCCCACGCTGGCATGAACGGCGAGCTGACCAGCCCAGGCGCTGCCTACGCCAGTTTACACAACATGTCGCCCCAGATGAGCGCCGCAGCCGCCGCGGCCGCCGTGGTGGCCTACGGGCGCTCCCCCATGGTGGGGTTTGATCCTCCCCCTCACATGAGAGTACCTACCATTCCTCCAAACCTGGCAGGAATCCCTGGGGGGAAACCTGCATACTCCTTCCACGTTACTGCAGACGGTCAGATGCAGCCTGTCCCTTTTCCCCCCGACGCCCTCATCGGACCCGGAATCCCCCGGCATGCTCGCCAGATCAACACCCTCAACCACGGGGAGGTGGTGTGCGCTGTGACCATCAGCAACCCCACGAGACACGTGTACACAGGCGGGAAGGGCTGCGTCAAGGTCTGGGACATCAGCCACCCTGGCAATAAGAGCCCTGTCTCCCAGCTCGACTGTCTGAACAGAGACAATTATATCCGTTCCTGTAAATTGCTACCCGATGGCTGCACTCTCATAGTGGGAGGGGAAGCCAGTACTTTGTCCATTTGGGACCTGGCGGCTCCAACCCCGCGCATCAAGGCGGAGCTGACGTCCTCGGCCCCCGCCTGCTACGCCCTGGCCATCAGCCCCGATTCCAAGGTCTGCTTCTCATGCTGCAGCGACGGCAACATCGCTGTGTGGGATCTGCACAACCAGACACTAGTGAGGCAATTCCAGGGCCACACAGACGGAGCCAGCTGTATTGACATTTCTAATGATGGCACCAAGCTCTGGACGGGTGGTTTGGACAACACAGTCAGGTCCTGGGACCTGCGCGAGGGGCGGCAGCTGCAGCAGCACGACTTCACCTCCCAGATCTTCTCCCTGGGGTACTGCCCCACCGGGGAGTGGCTGGCAGTGGGCATGGAGAGCAGCAATGTGGAGGTGCTGCACGTGAACAAGCCTGACAAGTACCAGCTGCACCTGCATGAGAGCTGCGTGCTGTCCCTGAAATTTGCTTACTGTGGTAAATGGTTTGTGAGTACTGGAAAAGATAACCTCCTCAATGCTTGGCGGACCCCCTATGGAGCCAGCATATTCCAGTCCAAAGAGTCCTCGTCAGTGCTTAGCTGTGACATCTCTGTGGATGATAAGTACATAGTCACTGGCTCGGGGGACAAGAAGGCTACAGTCTATGAAGTCATCTACTGACTCGAG
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGG SAGLLALSSALSGQSHLAIKDDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSDGDKSDDNLVVDVSNEDPSSP RASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAGLDFHL ELVPGNGKFGLKEKSWILSRKSSFEIKSAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVGFDPPPHM RVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCL NRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISND GTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRT PYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY*
Price: £125.00
Completion Time: 
43
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

GNB2

DU Number: 
DU63846
Plasmid: 
pcDNA5D F/T 3FLAG GSGSGS NLS GNB2
Expressed: 
3FLAG GSGSGS NLS GNB2
Genbank: 
NM_005273.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGAGTGAGCTGGAGCAACTGAGACAGGAGGCCGAGCAGCTCCGGAACCAGATCCGGGATGCCCGAAAAGCATGTGGGGACTCAACACTGACCCAGATCACAGCTGGGCTGGACCCAGTGGGGAGAATCCAGATGAGGACCCGGAGGACCCTCCGTGGGCACCTGGCAAAGATCTATGCCATGCACTGGGGGACCGACTCAAGGCTGCTGGTCAGCGCCTCCCAGGATGGGAAGCTCATCATCTGGGACAGCTACACCACCAACAAGGTCCACGCCATCCCGCTGCGCTCCTCCTGGGTAATGACCTGTGCCTACGCGCCCTCAGGGAACTTTGTGGCCTGTGGGGGGTTGGACAACATCTGCTCCATCTACAGCCTCAAGACCCGCGAGGGCAACGTCAGGGTCAGCCGGGAGCTGCCTGGCCACACTGGGTACCTGTCGTGTTGCCGCTTCCTGGATGACAACCAAATCATCACCAGCTCTGGGGATACCACCTGTGCCCTGTGGGACATTGAGACAGGCCAGCAGACAGTGGGTTTTGCTGGACACAGTGGGGATGTGATGTCCCTGTCCCTGGCCCCCGATGGCCGCACGTTTGTGTCAGGCGCCTGTGATGCCTCTATCAAGCTGTGGGACGTGCGGGATTCCATGTGCCGACAGACCTTCATCGGCCATGAATCCGACATCAATGCAGTGGCTTTCTTCCCCAACGGCTACGCCTTCACCACCGGCTCTGACGACGCCACGTGCCGCCTCTTCGACCTGCGGGCCGATCAGGAGCTCCTCATGTACTCCCATGACAACATCATCTGTGGCATCACCTCTGTTGCCTTCTCGCGCAGCGGACGGCTGCTGCTCGCTGGCTACGACGACTTCAACTGCAACATCTGGGATGCCATGAAGGGCGACCGTGCAGGAGTCCTCGCTGGCCACGACAACCGCGTGAGCTGCCTCGGGGTCACCGACGATGGCATGGCTGTGGCCACGGGCTCCTGGGACTCCTTCCTCAAGATCTGGAACTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITS SGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQE LLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN*
Price: £125.00
Completion Time: 
31
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

PAFAH1B1/LIS1

cDNA Synonyms: 
PAFAH1B1; LIS2; MDCR; MDS; NudF; PAFAH
DU Number: 
DU63842
Plasmid: 
pcDNA5D F/T 3FLAG GSGSGS NLS LIS1
Expressed: 
3FLAG GSGSGS NLS LIS1
Genbank: 
NM_000430.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
aGATCTATGGTGCTGTCCCAGAGACAACGAGATGAACTAAATCGAGCTATAGCAGATTATCTTCGTTCAAATGGCTATGAAGAGGCATATTCAGTTTTTAAAAAGGAAGCTGAATTAGATGTGAATGAAGAATTAGATAAAAAGTATGCTGGTCTTTTGGAAAAAAAATGGACATCTGTTATTAGATTACAAAAGAAGGTTATGGAATTAGAATCAAAGCTAAATGAAGCAAAAGAAGAATTTACGTCAGGTGGACCTCTTGGTCAGAAACGAGACCCAAAAGAATGGATTCCCCGTCCGCCAGAAAAATATGCATTGAGTGGTCACAGGAGTCCAGTCACTCGAGTCATTTTCCATCCTGTGTTCAGTGTTATGGTCTCTGCTTCAGAGGATGCTACAATTAAGGTGTGGGATTATGAGACTGGAGATTTTGAACGAACTCTTAAAGGACATACAGACTCTGTACAGGACATTTCATTCGACCACAGCGGCAAGCTTCTGGCTTCCTGTTCTGCAGATATGACCATTAAACTATGGGATTTTCAGGGCTTTGAATGCATCAGAACCATGCACGGCCATGACCACAATGTTTCTTCAGTAGCCATCATGCCCAATGGAGATCATATAGTGTCTGCCTCAAGGGATAAAACTATAAAAATGTGGGAAGTGCAAACTGGCTACTGTGTGAAGACATTCACAGGACACAGAGAATGGGTACGTATGGTACGGCCAAATCAAGATGGCACTCTGATAGCCAGCTGTTCCAATGACCAGACTGTGCGTGTATGGGTCGTAGCAACAAAGGAATGCAAGGCTGAGCTCCGAGAGCATGAGCATGTGGTAGAATGCATTTCCTGGGCTCCAGAAAGCTCATATTCCTCCATCTCTGAAGCAACAGGATCTGAGACTAAAAAAAGTGGTAAACCTGGGCCATTCTTGCTGTCTGGATCCAGAGACAAGACTATTAAGATGTGGGATGTCAGTACTGGCATGTGCCTTATGACCCTCGTGGGTCATGATAACTGGGTACGTGGAGTTCTGTTCCATTCTGGGGGGAAGTTTATTTTGAGTTGTGCTGATGACAAGACCCTACGCGTATGGGATTACAAGAACAAGCGATGCATGAAGACCCTCAATGCGCATGAACACTTTGTTACCTCCTTGGATTTCCACAAGACGGCACCCTATGTCGTCACTGGCAGCGTAGATCAAACAGTAAAAGTGTGGGAGTGCCGTTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIR LQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDH SGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRV WVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDK TLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR*
Price: £125.00
Completion Time: 
31
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WDR5

cDNA Synonyms: 
BIG-3; CFAP89; SWD3
DU Number: 
DU63869
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS WDR5
Expressed: 
3FLAG GSGSGS NLS WDR5
Genbank: 
NM_017588.2 with one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCGCCATGGCGACGGAGGAGAAGAAGCCTGAGACCGAGGCCGCCAGAGCACAGCCAACCCCTTCGTCATCCGCCACTCAGAGCAAGCCTACACCTGTGAAGCCAAACTATGCTCTAAAGTTCACCCTTGCTGGCCACACCAAAGCAGTGTCCTCCGTGAAATTCAGCCCGAATGGAGAGTGGCTGGCAAGTTCATCTGCTGATAAACTTATTAAAATTTGGGGCGCGTATGATGGGAAATTTGAGAAAACCATATCTGGTCACAAGCTGGGAATATCCGATGTAGCCTGGTCGTCAGATTCTAACCTTCTTGTTTCTGCCTCAGATGACAAAACCTTGAAGATATGGGACGTGAGCTCGGGCAAGTGTCTGAAAACCCTGAAGGGACACAGTAATTATGTCTTTTGCTGCAACTTCAATCCCCAGTCCAACCTTATTGTCTCAGGATCCTTTGACGAAAGCGTGAGGATATGGGATGTGAAAACAGGGAAGTGCCTCAAGACTTTGCCAGCTCACTCGGATCCAGTCTCGGCCGTTCATTTTAATCGTGATGGATCCTTGATAGTTTCAAGTAGCTATGATGGTCTCTGTCGCATCTGGGACACCGCCTCAGGCCAGTGCCTGAAGACGCTCATCGATGACGACAACCCCCCCGTGTCTTTTGTGAAGTTCTCCCCGAACGGCAAATACATCCTGGCCGCCACGCTGGACAACACTCTGAAGCTCTGGGACTACAGCAAGGGGAAGTGCCTGAAGACGTACACTGGCCACAAGAATGAGAAATACTGCATATTTGCCAATTTCTCTGTTACTGGTGGGAAGTGGATTGTGTCTGGCTCAGAGGATAACCTTGTTTACATCTGGAACCTTCAGACGAAAGAGATTGTACAGAAACTACAAGGCCACACAGATGTCGTGATCTCAACAGCTTGTCACCCAACAGAAAACATCATCGCCTCTGCTGCGCTAGAAAATGACAAAACAATTAAACTGTGGAAGAGTGACTGCTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSPGEFAMATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSP NGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRI WDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH KNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC*
Price: £125.00
Completion Time: 
31
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WDR5B

DU Number: 
DU63843
Plasmid: 
pcDNA5D F/T 3FLAG GSGSGS NLS WDR5B
Expressed: 
3FLAG GSGSGS NLS WDR5B
Genbank: 
NM_019069.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCAACCAAGGAGTCAAGAGACGCCAAAGCACAGTTGGCCCTCTCCTCATCGGCCAATCAGAGCAAGGAAGTGCCTGAAAACCCAAACTATGCTCTCAAATGTACTCTTGTGGGACACACGGAAGCAGTGTCATCAGTTAAGTTTAGTCCTAATGGAGAATGGCTAGCAAGTTCTTCTGCTGATAGGCTAATCATAATTTGGGGAGCATATGATGGAAAATATGAGAAAACACTCTATGGTCATAATTTGGAAATATCGGATGTTGCCTGGTCATCAGATTCCAGTCGTCTTGTTTCTGCCTCAGATGATAAAACTCTAAAATTATGGGATGTGAGATCTGGAAAATGTTTGAAAACACTGAAGGGGCACAGTAATTATGTCTTTTGTTGTAACTTCAATCCGCCATCCAACCTTATAATCTCGGGATCTTTTGATGAGACTGTAAAAATATGGGAGGTGAAAACAGGAAAGTGTCTCAAGACTTTGTCTGCTCATTCTGACCCAGTTTCTGCTGTTCATTTTAATTGTAGTGGGTCCTTGATAGTGTCAGGTAGCTATGATGGCCTCTGTAGAATCTGGGATGCTGCATCAGGTCAGTGTTTAAAAACGCTCGTTGATGACGATAACCCTCCTGTCTCTTTTGTAAAATTTTCTCCAAATGGTAAATACATTCTCACTGCAACTTTGGACAACACTCTTAAACTATGGGATTATAGCAGAGGCAGGTGCCTGAAAACATACACTGGTCATAAGAATGAGAAATATTGCATATTTGCCAATTTTTCAGTTACTGGTGGAAAGTGGATTGTGTCTGGTTCCGAGGATAACCTGGTTTACATTTGGAACCTTCAGACTAAAGAGATTGTGCAGAAATTACAAGGCCATACAGATGTTGTGATCTCAGCAGCTTGTCATCCTACAGAAAACCTCATCGCATCAGCAGCATTAGAAAATGACAAAACAATTAAACTGTGGATGAGTAACCACTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMATKESRDAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEAVSSVKFSPNGEWLASSS ADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCL KTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFA NFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLWMSNH*
Price: £125.00
Completion Time: 
31
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WDR53

DU Number: 
DU63844
Plasmid: 
pcDNA5D F/T 3FLAG GSGSGS NLS WDR53
Expressed: 
3FLAG GSGSGS NLS WDR53
Genbank: 
NM_001345906.1 with one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCAGTCAAGTGGACGGGTGGGCATTCTTCTCCTGTCCTCTGCCTGAATGCAAGTAAAGAAGGGCTGCTGGCTTCTGGAGCAGAGGGCGGAGATCTCACGGCTTGGGGTGAAGATGGAACTCCATTAGGACACACGCGGTTCCAAGGGGCTGATGATGTTACCAGTGTCTTATTTTCTCCCTCCTGTCCCACCAAGCTCTATGCCTCACATGGAGAAACCATTAGTGTACTGGATGTCAGGTCCCTCAAAGATTCCTTGGACCATTTTCATGTGAATGAAGAAGAAATCAATTGTCTTTCATTGAATCAAACGGAAAACCTGCTGGCTTCTGCTGACGACTCTGGGGCAATCAAAATCCTAGACTTGGAAAACAAGAAAGTTATCAGATCCTTGAAGAGACATTCCAATATCTGCTCCTCAGTGGCTTTTCGGCCTCAGAGGCCTCAGAGCCTGGTGTCATGTGGACTGGATATGCAGGTGATGCTGTGGAGTCTTCAAAAAGCCCGACCACTCTGGATTACAAATTTACAGGAGGATGAAACAGAAGAAATGGAAGGCCCACAGTCACCTGGTCAGCTCTTAAACCCTGCCCTAGCCCATTCTATCTCTGTGGCTTCGTGTGGTAATATTTTTAGTTGTGGTGCAGAAGATGGTAAGGTTCGAATCTTTCGGGTGATGGGAGTTAAGTGTGAACAGGAACTGGGATTTAAGGGCCACACTTCAGGGGTATCCCAGGTCTGCTTTCTCCCAGAATCCTATTTGCTGCTTACTGGAGGGAATGATGGGAAGATCACGTTGTGGGATGCAAACAGTGAAGTTGAGAAAAAACAGAAGAGTCCCACAAAACGTACCCACAGGAAGAAACCTAAAAGAGGAACTTGCACCAAGCAGGGTGGAAATACTAACGCTTCAGTAACAGATGAGGAAGAACATGGCAACATTTTACCGAAGCTAAATATTGAACATGGAGAAAAAGTGAACTGGCTCTTGGGTACAAAAATAAAGGGACACCAAAATATATTAGTAGCTGATCAAACTAGTTGTATATCTGTATACCCCTTAAATGAATTTTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMAVKWTGGHSSPVLCLNASKEGLLASGAEGGDLTAWGEDGTPLGHTRFQGADDVTSVLFS PSCPTKLYASHGETISVLDVRSLKDSLDHFHVNEEEINCLSLNQTENLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCGLDMQ VMLWSLQKARPLWITNLQEDETEEMEGPQSPGQLLNPALAHSISVASCGNIFSCGAEDGKVRIFRVMGVKCEQELGFKGHTSGVSQVCFLPESYLLLTGG NDGKITLWDANSEVEKKQKSPTKRTHRKKPKRGTCTKQGGNTNASVTDEEEHGNILPKLNIEHGEKVNWLLGTKIKGHQNILVADQTSCISVYPLNEF*
Price: £125.00
Completion Time: 
31
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WDR76

cDNA Synonyms: 
CDW14
DU Number: 
DU63874
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS WDR76
Expressed: 
3FLAG GSGSGS NLS WDR76
Genbank: 
NM_024908.3 with residue change S153A (Natural variant,RNA-derived)
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
aGATCTATGTCCAGGTCGGGCGCGGCGGCTGAGAAGGCGGACTCCAGACAGCGACCCCAGATGAAGGTAAATGAATATAAAGAAAATCAAAACATCGCTTATGTGTCTCTGAGACCAGCACAGACTACAGTTTTAATAAAAACAGCTAAGGTCTATCTTGCCCCCTTTTCACTCAGTAATTACCAGCTAGACCAGCTTATGTGCCCCAAATCCCTATCAGAAAAGAATTCTAACAATGAAGTGGCGTGTAAGAAGACTAAAATAAAGAAAACTTGCAGAAGGATTATACCTCCAAAGATGAAAAACACATCTTCCAAGGCAGAATCCACGCTGCAAAATTCATCCTCAGCTGTTCATACTGAAAGTAACAAGCTACAACCCAAGAGAACGGCAGATGCGATGAATCTCAGTGTTGATGTGGAAAGTAGTCAGGATGGAGACAGTGATGAAGATACCACACCAGCCCTGGATTTTTCGGGATTGTCACCCTACGAAAGGAAGAGACTGAAGAACATATCAGAAAACGCAGACTTTTTTGCTTCTCTTCAGTTGTCTGAGTCTGCTGCAAGACTCCGTGAAATGATAGAGAAGAGACAGCCTCCTAAATCCAAAAGAAAGAAGCCTAAGAGAGAAAATGGGATTGGATGTAGAAGGTCAATGCGATTACTAAAAGTTGATCCTTCGGGAGTTTCATTACCAGCAGCTCCAACACCGCCGACATTAGTAGCAGATGAAACTCCTTTGTTACCTCCTGGGCCTTTAGAAATGACTTCTGAAAATCAAGAAGACAACAATGAACGATTTAAAGGATTTCTGCACACATGGGCAGGAATGAGCAAGCCAAGTAGTAAGAACACTGAGAAGGGATTATCTAGCATTAAAAGCTACAAAGCCAATTTAAATGGCATGGTCATTAGTGAAGATACCGTTTACAAAGTTACCACAGGCCCAATATTCTCTATGGCTCTCCATCCATCAGAAACTAGAACTTTGGTAGCAGTTGGGGCCAAATTTGGGCAAGTTGGACTTTGTGATTTGACCCAGCAACCTAAAGAAGATGGAGTTTATGTTTTTCATCCCCATAGTCAGCCAGTTAGCTGTCTTTACTTCTCACCCGCCAATCCGGCCCACATACTGTCACTGAGCTATGATGGCACGTTACGCTGTGGGGATTTTTCCAGGGCTATTTTTGAAGAGGTGTATAGAAATGAAAGAAGTAGCTTTTCCTCCTTCGACTTCTTGGCAGAAGATGCCTCCACTTTAATAGTAGGACACTGGGATGGAAATATGTCACTGGTGGATAGACGGACACCTGGAACTTCTTATGAGAAACTTACCAGTTCTTCTATGGGAAAAATAAGAACTGTTCATGTCCACCCAGTGCATAGACAGTATTTTATCACTGCCGGATTGAGGGATACTCATATTTATGATGCAAGGCGATTGAATTCCAGGAGAAGTCAGCCTTTGATTTCTTTGACTGAACATACAAAGAGCATTGCTTCCGCCTATTTTTCACCTCTTACTGGTAACAGAGTGGTGACCACATGTGCTGATTGTAATCTGAGAATTTTTGACAGCAGCTGTATATCTTCTAAGATTCCGCTCCTCACCACCATCAGGCACAACACTTTCACTGGGCGATGGCTGACCAGGTTCCAAGCCATGTGGGATCCTAAACAAGAAGACTGTGTCATAGTTGGCAGCATGGCCCATCCACGACGGGTAGAAATCTTCCATGAGACAGGAAAGAGGGTGCATTCGTTTGGTGGAGAATACCTTGTCTCTGTGTGTTCCATCAATGCCATGCACCCAACTCGGTATATTTTGGCTGGAGGTAATTCCAGCGGGAAGATACATGTTTTTATGAATGAAAAAAGCTGCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMSRSGAAAEKADSRQRPQMKVNEYKENQNIAYVSLRPAQTTVLIKTAKVYLAPFSLSNYQ LDQLMCPKSLSEKNSNNEVACKKTKIKKTCRRIIPPKMKNTSSKAESTLQNSSSAVHTESNKLQPKRTADAMNLSVDVESSQDGDSDEDTTPALDFSGLS PYERKRLKNISENADFFASLQLSESAARLREMIEKRQPPKSKRKKPKRENGIGCRRSMRLLKVDPSGVSLPAAPTPPTLVADETPLLPPGPLEMTSENQE DNNERFKGFLHTWAGMSKPSSKNTEKGLSSIKSYKANLNGMVISEDTVYKVTTGPIFSMALHPSETRTLVAVGAKFGQVGLCDLTQQPKEDGVYVFHPHS QPVSCLYFSPANPAHILSLSYDGTLRCGDFSRAIFEEVYRNERSSFSSFDFLAEDASTLIVGHWDGNMSLVDRRTPGTSYEKLTSSSMGKIRTVHVHPVH RQYFITAGLRDTHIYDARRLNSRRSQPLISLTEHTKSIASAYFSPLTGNRVVTTCADCNLRIFDSSCISSKIPLLTTIRHNTFTGRWLTRFQAMWDPKQE DCVIVGSMAHPRRVEIFHETGKRVHSFGGEYLVSVCSINAMHPTRYILAGGNSSGKIHVFMNEKSC*
Price: £125.00
Completion Time: 
35
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WSB1

cDNA Synonyms: 
SWIP1; WSB-1
DU Number: 
DU63845
Plasmid: 
pcDNA5D F/T 3FLAG GSGSGS NLS WSB1
Expressed: 
3FLAG GSGSGS NLS WSB1
Genbank: 
NM_015626.9
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
aGATCTATGGCCAGCTTTCCCCCGAGGGTCAACGAGAAAGAGATCGTGAGATTACGTACTATAGGTGAACTTTTAGCTCCTGCAGCTCCTTTTGACAAGAAATGTGGTCGTGAAAATTGGACTGTTGCTTTTGCTCCAGATGGTTCATACTTTGCTTGGTCACAAGGACATCGCACAGTAAAGCTTGTTCCGTGGTCCCAGTGCCTTCAGAACTTTCTCTTGCATGGCACCAAGAATGTTACCAATTCAAGCAGTTTAAGATTGCCAAGACAAAATAGTGATGGTGGTCAGAAAAATAAGCCTCGTGAACATATTATAGACTGTGGAGATATAGTCTGGAGTCTTGCTTTTGGGTCATCAGTTCCAGAAAAACAGAGTCGCTGTGTAAATATAGAATGGCATCGCTTCAGATTTGGACAAGATCAGCTACTTCTTGCTACAGGGTTGAACAATGGGCGTATCAAAATATGGGATGTATATACAGGAAAACTCCTCCTTAACTTGGTAGATCATACTGAAGTGGTCAGAGATTTAACTTTTGCTCCAGATGGAAGCTTGATCCTGGTGTCAGCTTCAAGAGACAAAACTCTCAGAGTATGGGACCTGAAAGATGATGGAAACATGATGAAAGTATTGAGGGGGCATCAGAATTGGGTGTACAGCTGTGCATTCTCTCCTGACTCTTCTATGCTGTGTTCAGTCGGAGCCAGTAAAGCAGTTTTCCTTTGGAATATGGATAAATACACCATGATACGGAAACTAGAAGGACATCACCATGATGTGGTAGCTTGTGACTTTTCTCCTGATGGAGCATTACTGGCTACTGCATCTTATGATACTCGAGTATATATCTGGGATCCACATAATGGAGACATTCTGATGGAATTTGGGCACCTGTTTCCCCCACCTACTCCAATATTTGCTGGAGGAGCAAATGACCGGTGGGTACGATCTGTATCTTTTAGCCATGATGGACTGCATGTTGCAAGCCTTGCTGATGATAAAATGGTGAGGTTCTGGAGAATTGATGAGGATTATCCAGTGCAAGTTGCACCTTTGAGCAATGGTCTTTGCTGTGCCTTCTCTACTGATGGCAGTGTTTTAGCTGCTGGGACACATGACGGAAGTGTGTATTTTTGGGCCACTCCACGGCAGGTCCCTAGCCTGCAACATTTATGTCGCATGTCAATCCGAAGAGTGATGCCCACCCAAGAAGTTCAGGAGCTGCCGATTCCTTCCAAGCTTTTGGAGTTTCTCTCGTATCGTATTTAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKL VPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTG KLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVV ACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAPLSNGLCCAFS TDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYRI*
Price: £125.00
Completion Time: 
31
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

DET1

DU Number: 
DU63867
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS DET1
Expressed: 
3FLAG GSGSGS NLS DET1
Genbank: 
NM_017996.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
aGATCTATGGTGGGACAGATACTAAAAAGAGATGTGATAATGGATCATCATGTTTCTACCATCAAGCCTCGAAGAATCCAAAACCAAAATGTCATTCACCGCTTGGAACGCCGGCGGATCAGTTCAGGCAAGGCAGGTACCCACTGGCACCAAGTCCGAGTGTTCCATCAGAATGTCTTCCCCAACTTCACAGTTGTCAACGTTGAAAAGCCTCCTTGTTTCTTGCGTAAATTCTCACCTGATGGACGCTACTTTATTGCTTTTTCTTCAGACCAGACATCTCTTGAAATCTATGAGTACCAGGGCTGCCAGGCAGCAGAGGACCTACTGCAGGGATACGAAGGAGAAATCCTGTCCAATGGCAATGACCAGCGGTCAGTGAATATCCGGGGCCGGCTCTTTGAACGCTTTTTTGTCCTGCTGCACATTACCAATGTTGCGGCCAATGGTGAGCACCTGAACCGGGAGTGTAGTCTCTTCACTGATGACTGCCGCTGTGTCATCGTGGGCTCAGCTGCCTACCTCCCAGATGAGCCTCACCCTCCATTTTTTGAGGTATATCGGAACAGTGAATCAGTGACCCCCAACCCACGGTCCCCTCTAGAAGACTATTCCCTCCATATCATTGACCTTCACACCGGCCGCTTATGTGATACACGCACGTTCAAGTGTGACAAGGTGGTCTTGTCACACAACCAAGGGCTGTACTTGTACAAAAACATCCTGGCCATCTTGTCTGTGCAACAACAGACCATCCATGTCTTCCAGGTGACTCCTGAAGGCACTTTCATTGATGTGCGGACCATTGGCCGCTTTTGCTATGAGGATGACCTGCTCACTGTGTCAGCTGTTTTCCCTGAGGTACAGCGGGACAGTCAGACAGGCATGGCCAATCCCTTTAGGGATCCTTTCATCAATTCCCTCAAACACCGGTTGCTGGTATATTTGTGGCGCCGGGCAGAACAGGATGGTAGTGCAATGGCCAAGAGGCGCTTCTTCCAGTATTTTGACCAACTGCGGCAGCTGCGAATGTGGAAAATGCAGCTTCTGGATGAAAACCACCTGTTTATCAAGTACACTAGTGAGGATGTAGTAACACTGCGAGTCACAGATCCATCACAGGCATCTTTCTTTGTGGTGTACAATATGGTGACGACAGAGGTGATTGCTGTGTTTGAGAATACATCAGATGAGCTTTTGGAGCTCTTTGAGAACTTCTGTGACCTTTTTCGTAATGCTACCCTGCACAGTGAAGTTCAGTTTCCCTGCTCAGCTTCTAGCAACAATTTTGCAAGGCAGATCCAGCGCCGGTTCAAAGACACTATTATAAATGCCAAGTATGGAGGGCACACAGAGGCAGTACGCCGGCTGCTGGGTCAGCTCCCCATCAGTGCTCAGTCTTACAGCGGTAGCCCCTATCTGGATTTGTCTCTCTTCAGTTATGATGACAAGTGGGTATCTGTCATGGAGCGGCCCAAGACTTGTGGAGATCACCCAATCAGGTTCTATGCCCGGGACTCGGGCCTGCTCAAGTTTGAGATCCAGGCGGGGTTATTGGGCCGCCCCATCAACCACACAGTGCGACGCCTTGTTGCCTTCACCTTTCACCCTTTTGAGCCTTTCGCTATTTCTGTGCAGAGGACTAATGCTGAGTATGTTGTCAACTTCCATATGCGACACTGCTGCACGTAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMVGQILKRDVIMDHHVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPN FTVVNVEKPPCFLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRLFERFFVLLHITNVAANGEHLNRECSLFTD DCRCVIVGSAAYLPDEPHPPFFEVYRNSESVTPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIHVFQVTPEGT FIDVRTIGRFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPFINSLKHRLLVYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKYTSE DVVTLRVTDPSQASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQIQRRFKDTIINAKYGGHTEAVRRLLGQLP ISAQSYSGSPYLDLSLFSYDDKWVSVMERPKTCGDHPIRFYARDSGLLKFEIQAGLLGRPINHTVRRLVAFTFHPFEPFAISVQRTNAEYVVNFHMRHCC T*
Price: £125.00
Completion Time: 
31
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

KATNB1

cDNA Synonyms: 
KAT; LIS6
DU Number: 
DU63870
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS KATNB1
Expressed: 
3FLAG GSGSGS NLS KATNB1
Genbank: 
NM_005886.2 with one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCCACCCCTGTGGTCACCAAGACAGCCTGGAAGTTGCAAGAGATCGTCGCGCATGCCAGCAACGTGTCCTCACTGGTGCTGGGCAAAGCCTCCGGGCGGCTGCTGGCTACAGGCGGGGATGACTGCCGCGTCAACCTGTGGTCCATCAACAAGCCCAACTGCATCATGAGCCTGACGGGCCACACATCCCCAGTGGAGAGCGTCCGCCTCAACACCCCCGAGGAGCTCATCGTGGCCGGCTCTCAGTCGGGCTCCATCCGTGTCTGGGACCTGGAAGCTGCCAAAATTCTTCGCACACTCATGGGACACAAAGCCAACATCTGCAGCCTGGATTTCCACCCGTACGGCGAGTTTGTAGCCTCTGGTTCCCAGGACACAAACATCAAGCTCTGGGACATCAGGAGGAAAGGCTGTGTCTTCCGATACAGGGGGCACAGCCAGGCCGTGCGGTGTCTCCGGTTCAGCCCCGATGGGAAGTGGTTGGCGTCGGCCGCAGATGACCACACCGTGAAGCTCTGGGATCTCACTGCCGGCAAGATGATGTCTGAGTTCCCTGGTCACACGGGGCCTGTCAACGTGGTCGAGTTTCACCCCAACGAGTACCTCCTGGCCTCCGGCAGCTCTGACAGGACAATCCGCTTCTGGGACCTGGAGAAGTTCCAGGTGGTGAGCTGCATCGAAGGGGAGCCTGGGCCCGTCAGGAGCGTCCTCTTCAACCCAGATGGCTGCTGCCTGTACAGCGGCTGCCAGGACTCACTGCGTGTCTACGGCTGGGAACCTGAGCGGTGCTTTGATGTGGTCCTCGTCAACTGGGGCAAGGTGGCCGACCTGGCCATCTGCAATGACCAGTTGATAGGTGTGGCCTTCTCCCAGAGCAACGTCTCCTCCTACGTGGTGGATCTGACGCGTGTCACCAGGACTGGCACGGTGGCCCGGGACCCTGTGCAGGACCACCGGCCCCTGGCACAGCCACTGCCCAACCCCAGCGCCCCCCTCCGGCGCATCTATGAGCGGCCCAGCACAACCTGCAGCAAGCCTCAGAGGGTGAAGCAGAACTCAGAGAGCGAGCGCCGCAGCCCCAGCAGCGAGGATGACCGGGACGAGCGCGAGTCCCGCGCGGAGATCCAGAACGCCGAGGACTACAACGAGATCTTCCAGCCCAAGAACAGCATCAGTCGGACGCCACCCCGGAGAAGTGAGCCCTTCCCTGCACCCCCAGAGGACGACGCAGCCACAGCAAAGGAGGCAGCAAAGCCCAGCCCTGCCATGGATGTGCAGTTCCCGGTGCCAAATCTGGAGGTCCTGCCCCGGCCCCCAGTGGTTGCTTCCACACCTGCACCCAAGGCTGAGCCTGCCATCATCCCTGCCACCCGGAACGAGCCCATCGGGCTGAAGGCCTCCGACTTCCTGCCCGCCGTGAAGATCCCCCAGCAGGCCGAGCTGGTGGACGAGGATGCCATGTCACAGATCCGCAAAGGCCACGACACCATGTGTGTGGTGCTCACCAGCCGCCACAAGAACCTGGACACTGTGCGGGCTGTGTGGACCATGGGCGACATCAAGACGTCGGTGGACTCCGCTGTGGCCATCAACGACCTGTCGGTGGTGGTGGACCTCCTGAACATCGTCAACCAGAAAGCCTCCCTGTGGAAGCTGGACCTGTGCACCACCGTCCTGCCACAGATTGAGAAGCTTCTGCAGAGCAAGTATGAGAGCTACGTCCAGACGGGCTGCACCTCCCTGAAGCTGATCCTGCAGCGGTTTCTGCCCCTCATCACAGACATGCTGGCGGCCCCACCCTCTGTGGGTGTGGATATCAGCAGGGAGGAGAGGCTGCATAAGTGCCGGCTCTGCTACAAGCAGCTTAAGAGCATCAGCGGCCTGGTCAAGAGCAAGTCAGGCCTGAGCGGCCGCCATGGCAGTACCTTCCGCGAGCTGCACCTGCTCATGGCCAGTCTGGACTGAGGATCC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMATPVVTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLT GHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGK WLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQDSLRVYGWE PERCFDVVLVNWGKVADLAICNDQLIGVAFSQSNVSSYVVDLTRVTRTGTVARDPVQDHRPLAQPLPNPSAPLRRIYERPSTTCSKPQRVKQNSESERRS PSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPRRSEPFPAPPEDDAATAKEAAKPSPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRN EPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVL PQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDMLAAPPSVGVDISREERLHKCRLCYKQLKSISGLVKSKSGLSGRHGSTFRELHLLMASLD*
Price: £125.00
Completion Time: 
31
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.