3FLAG

FBXO16

cDNA Synonyms: 
FBX16
DU Number: 
DU63957
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS FBXO16
Expressed: 
3FLAG GSGSGS NLS FBXO16
Genbank: 
NM_172366.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGATGGCATTTGCACCTCCAAAAAACACAGATGGTCCCAAAATGCAGACAAAGATGAGCACCTGGACACCCCTAAACCATCAGCTATTGAATGACCGGGTATTTGAAGAAAGAAGAGCCCTGCTTGGCAAATGGTTTGACAAATGGACAGACTCTCAAAGAAGAAGAATCCTCACAGGCCTGTTGGAGCGCTGCTCGCTGTCCCAGCAAAAGTTCTGCTGTCGAAAGCTTCAAGAGAAAATTCCAGCAGAAGCCCTGGACTTTACAACCAAGCTTCCAAGGGTGTTATCTTTATACATCTTTTCTTTCCTGGACCCTCGGAGCCTTTGTCGTTGTGCACAGGTGTGCTGGCATTGGAAGAACCTTGCTGAGCTGGACCAGCTCTGGATGCTGAAATGTTTACGGTTTAACTGGTACATCAATTTCTCTCCAACTCCCTTTGAGCAGGGGATCTGGAAGAAGCACTATATTCAAATGGTGAAAGAACTTCATATTACCAAGCCTAAGACACCCCCAAAGGATGGATTTGTAATCGCTGACGTTCAACTAGTTACAAGCAATTCTCCAGAGGAAAAACAGTCCCCTTTATCAGCTTTTCGGTCCTCTTCCTCTTTAAGAAAGAAGAATAACTCAGGGGAGAAAGCACTTCCACCCTGGCGATCTTCTGATAAGCACCCAACAGATATCATTCGTTTTAATTACCTAGACAACCGTGACCCCATGGAGACTGTCCAGCAAGGAAGAAGAAAAAGAAACCAAATGACCCCAGACTTCAGCCGACAGTCACATGATAAGAAAAATAAATTGCAGGACAGAACTAGGCTAAGAAAAGCACAATCAATGATGTCGAGGAGAAATCCCTTCCCACTATGTCCCTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTG LLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMV KELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSR QSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP*
Price: £125.00
Completion Time: 
8
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Skp2

cDNA Synonyms: 
FBL1; FBXL1; FLB1; p45
DU Number: 
DU63964
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS Skp2 (FBXL1)
Expressed: 
3FLAG GSGSGS NLS Skp2 (FBXL1)
Genbank: 
NM_032637.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GCGGCCGCGATGCACAGGAAGCACCTCCAGGAGATTCCAGACCTGAGTAGCAACGTTGCCACCAGCTTCACGTGGGGATGGGATTCCAGCAAGACTTCTGAACTGCTGTCAGGCATGGGGGTCTCCGCCCTGGAGAAAGAGGAGCCCGACAGTGAGAACATCCCCCAGGAACTGCTCTCAAACCTGGGCCACCCGGAGAGCCCCCCACGGAAACGGCTGAAGAGCAAAGGGAGTGACAAAGACTTTGTGATTGTCCGCAGGCCTAAGCTAAATCGAGAGAACTTTCCAGGTGTTTCATGGGACTCCCTTCCGGATGAGCTGCTCTTGGGAATCTTTTCCTGTCTGTGCCTCCCTGAGCTGCTAAAGGTCTCTGGTGTTTGTAAGAGGTGGTATCGCCTAGCGTCTGATGAGTCTCTATGGCAGACCTTAGACCTCACAGGTAAAAATCTGCACCCGGATGTGACTGGTCGGTTGCTGTCTCAAGGGGTGATTGCCTTCCGCTGCCCACGATCATTTATGGACCAACCATTGGCTGAACATTTCAGCCCTTTTCGTGTACAGCACATGGACCTATCGAACTCAGTTATAGAAGTGTCCACCCTCCACGGCATACTGTCTCAGTGTTCCAAGTTGCAGAATCTAAGCCTGGAAGGCCTGCGGCTTTCGGATCCCATTGTCAATACTCTCGCAAAAAACTCAAATTTAGTGCGACTTAACCTTTCTGGGTGTTCTGGATTCTCTGAATTTGCCCTGCAGACTTTGCTAAGCAGCTGTTCCAGACTGGATGAGCTGAACCTCTCCTGGTGTTTTGATTTCACTGAAAAGCATGTACAGGTGGCTGTTGCGCATGTGTCAGAGACCATCACCCAGCTGAATCTTAGCGGCTACAGAAAGAATCTCCAGAAATCAGATCTCTCTACTTTAGTTAGAAGATGCCCCAATCTTGTCCATCTAGACTTAAGTGATAGTGTCATGCTAAAGAATGACTGCTTTCAGGAATTTTTCCAGCTCAACTACCTCCAACACCTATCACTCAGTCGGTGCTATGATATAATACCTGAAACTTTACTATTAGTGACAAGAGCTGGGGTTAGGATCCGGTTGGACTCTGACATCGGATGCCCTCAAACATACAGAACTTCCAAACTCAAGTCCAGCCATAAGCTATTTTGCCAACATGTCAGAGTAATCTGTATTTTTGTATGTGATTTCTACTTTTATAGACTTGTTTTAAAACAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSPGEFASLEKLAAAMHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPD SENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNL HPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFA LQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYD IIPETLLLVTRAGVRIRLDSDIGCPQTYRTSKLKSSHKLFCQHVRVICIFVCDFYFYRLVLKQ*
Price: £125.00
Completion Time: 
9
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WDR12

cDNA Synonyms: 
YTM1
DU Number: 
DU63902
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS WDR12
Expressed: 
3FLAG GSGSGS NLS WDR12
Genbank: 
NM_018256.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GCGGCCGCGATGGCTCAGCTCCAAACACGCTTCTACACTGATAACAAGAAATATGCCGTAGATGATGTTCCCTTCTCAATCCCTGCTGCCTCTGAAATTGCCGACCTTAGTAACATCATCAATAAACTACTAAAGGACAAAAATGAGTTCCACAAACATGTGGAGTTTGATTTCCTTATTAAGGGCCAGTTTCTGCGAATGCCCTTGGACAAACACATGGAAATGGAGAACATCTCATCAGAAGAAGTTGTGGAAATAGAATACGTGGAGAAGTATACTGCACCCCAGCCAGAGCAATGCATGTTCCATGATGACTGGATCAGTTCAATTAAAGGGGCAGAGGAATGGATCTTGACTGGTTCTTATGATAAGACTTCTCGGATCTGGTCCTTGGAAGGAAAGTCAATAATGACAATTGTGGGACATACGGATGTTGTAAAAGATGTGGCCTGGGTGAAAAAAGATAGTTTGTCCTGCTTATTATTGAGTGCTTCTATGGATCAGACTATTCTCTTATGGGAGTGGAATGTAGAGAGAAACAAAGTGAAAGCCCTACACTGCTGTAGAGGTCATGCTGGAAGTGTAGATTCTATAGCTGTTGATGGCTCAGGAACTAAATTTTGCAGTGGCTCCTGGGATAAGATGCTAAAGATCTGGTCTACAGTCCCTACAGATGAAGAAGATGAAATGGAGGAGTCCACAAATCGACCAAGAAAGAAACAGAAGACAGAACAGTTGGGACTAACAAGGACTCCCATAGTGACCCTCTCTGGCCACATGGAGGCAGTTTCCTCAGTTCTGTGGTCAGATGCTGAAGAAATCTGCAGTGCATCTTGGGACCATACAATTAGAGTGTGGGATGTTGAGTCTGGCAGTCTTAAGTCAACTTTGACAGGAAATAAAGTGTTTAATTGTATTTCCTATTCTCCACTTTGTAAACGTTTAGCATCTGGAAGCACAGATAGGCATATCAGACTGTGGGATCCCCGAACTAAAGATGGTTCTTTGGTGTCGCTGTCCCTAACGTCACATACTGGTTGGGTGACATCAGTAAAATGGTCTCCTACCCATGAACAGCAGCTGATTTCAGGATCTTTAGATAACATTGTTAAGCTGTGGGATACAAGAAGTTGTAAGGCTCCTCTCTATGATCTGGCTGCTCATGAAGACAAAGTTCTGAGTGTAGACTGGACAGACACAGGGCTACTTCTGAGTGGAGGAGCAGACAATAAATTGTATTCCTACAGATATTCACCTACCACTTCCCATGTTGGGGCATGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSPGEFASLEKLAAAMAQLQTRFYTDNKKYAVDDVPFSIPAASEIADLSNIINKLLKDKNEF HKHVEFDFLIKGQFLRMPLDKHMEMENISSEEVVEIEYVEKYTAPQPEQCMFHDDWISSIKGAEEWILTGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVA WVKKDSLSCLLLSASMDQTILLWEWNVERNKVKALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEESTNRPRKKQKTEQLGLTR TPIVTLSGHMEAVSSVLWSDAEEICSASWDHTIRVWDVESGSLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTSHTGWVTS VKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSHVGA*
Price: £125.00
Completion Time: 
12
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WDR59

cDNA Synonyms: 
CDW12; FP977; p90-120
DU Number: 
DU63893
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS WDR59
Expressed: 
3FLAG GSGSGS NLS WDR59
Genbank: 
NM_030581.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCGGCGCGATGGAGCAGCGAAAACGTGGTTGTAGAGTTCCGTGACTCCCAGGCAACTGCGATGTCTGTGGACTGTCTTGGGCAGCATGCAGTGCTTTCTGGCCGCAGATTCTTATACATCGTCAATCTAGATGCCCCTTTCGAAGGTCACCGAAAGATCTCTCGCCAGAGCAAATGGGACATTGGAGCTGTGCAGTGGAATCCTCATGACAGCTTTGCACACTATTTTGCGGCTTCGAGTAACCAACGAGTAGACCTTTACAAGTGGAAAGACGGCAGTGGGGAAGTTGGCACAACCTTACAAGGCCACACTCGTGTCATCAGCGACTTGGACTGGGCGGTGTTTGAGCCTGACCTCCTGGTTACCAGCTCTGTGGACACCTACATCTACATTTGGGATATCAAAGACACAAGGAAACCTACTGTTGCACTGTCTGCTGTTGCGGGTGCCTCCCAGGTCAAATGGAATAAAAAAAATGCTAACTGCCTTGCCACCAGCCATGACGGCGATGTGCGGATATGGGATAAGAGGAAACCCAGTACAGCAGTGGAATATCTAGCCGCCCACCTCTCCAAAATCCATGGCCTGGACTGGCACCCAGACAGCGAGCACATTCTTGCTACCTCCAGTCAAGACAATTCTGTGAAGTTCTGGGATTACCGCCAGCCTCGGAAATACCTCAATATTCTTCCTTGCCAGGTGCCTGTCTGGAAGGCCAGATACACACCTTTCAGCAATGGATTGGTGACTGTGATGGTTCCCCAGCTGCGGAGGGAAAACAGCCTTCTCCTGTGGAATGTCTTTGACTTGAACACCCCAGTCCACACCTTCGTGGGGCATGATGATGTGGTCCTGGAGTTCCAGTGGAGGAAGCAGAAGGAAGGGTCCAAGGACTATCAACTGGTGACGTGGTCCCGGGATCAGACCTTGAGAATGTGGCGGGTGGATTCCCAGATGCAGAGGCTTTGTGCAAATGACATATTAGATGGTGTTGATGAGTTCATTGAGAGTATTTCCCTTCTGCCGGAACCTGAGAAGACCCTGCACACTGAAGATACAGATCACCAGCACACTGCAAGCCATGGGGAGGAAGAAGCCCTAAAAGAAGATCCCCCTAGAAATCTCCTGGAAGAGAGGAAATCAGATCAACTGGGGCTGCCTCAGACCTTGCAGCAGGAATTCTCCCTGATCAATGTGCAAATCCGGAATGTCAATGTGGAGATGGATGCGGCAGACAGGAGCTGCACAGTGTCTGTGCACTGCAGCAACCATCGTGTCAAGATGCTGGTGAAGTTCCCTGCACAGTACCCAAACAACGCCGCCCCTTCCTTCCAGTTTATTAACCCCACAACCATCACATCCACCATGAAAGCTAAGCTGCTGAAGATCCTGAAGGACACAGCCCTGCAGAAAGTGAAGCGTGGCCAGAGCTGCCTGGAGCCCTGCCTGCGCCAGCTCGTCTCCTGCCTTGAGTCCTTTGTGAACCAGGAAGACAGCGCTTCCAGCAACCCGTTTGCACTCCCCAACTCTGTCACTCCCCCCTTACCGACGTTTGCGCGGGTGACCACGGCTTACGGGTCGTACCAGGACGCCAACATTCCCTTTCCTAGGACTTCTGGGGCCAGGTTCTGCGGAGCAGGTTACCTGGTATATTTCACAAGGCCCATGACAATGCATCGGGCGGTGTCTCCCACAGAGCCTACTCCGAGATCTCTCTCAGCCTTGTCTGCTTATCACACTGGCTTGATCGCGCCCATGAAGATCCGCACAGAGGCCCCTGGGAACCTTCGTTTATACAGTGGGAGCCCCACTCGCAGCGAGAAAGAGCAGGTCTCCATCAGCTCCTTCTACTACAAGGAGCGGAAATCAAGACGATGGAAAAGTAAGCGTGAGGGATCAGACTCTGGCAATCGACAGATCAAGGCTGCTGGGAAAGTCATCATCCAGGATATTGCTTGCCTCCTGCCTGTTCACAAATCGCTGGGAGAGCTGTACATATTGAATGTGAATGATATTCAGGAAACATGTCAGAAGAATGCCGCCTCTGCCTTGCTCGTTGGAAGAAAGGATCTTGTCCAGGTTTGGTCGCTGGCTACGGTAGCTACAGATCTTTGCCTTGGTCCGAAATCTGACCCAGATTTGGAAACACCCTGGGCTCGACATCCATTTGGGCGGCAGCTGCTGGAGTCCCTGTTGGCTCACTATTGCCGGCTCCGGGATGTTCAGACACTGGCGATGCTCTGTAGCGTGTTTGAAGCCCAGTCTCGGCCTCAGGGGCTACCAAACCCCTTTGGGCCTTTTCCTAACCGTTCTTCTAATCTTGTGGTGTCCCATAGTCGATATCCTAGCTTTACCTCTTCTGGTTCCTGCTCCAGTATGTCAGACCCAGGGCTCAACACTGGCGGCTGGAACATAGCGGGAAGAGAGGCAGAGCACTTGTCCTCCCCTTGGGGAGAATCCTCACCAGAAGAGCTCCGCTTTGGGAGTCTGACCTACAGTGATCCCCGTGAGCGAGAACGCGACCAGCATGATAAAAATAAAAGGCTCCTGGACCCCGCCAATACCCAGCAATTTGATGACTTTAAGAAATGCTATGGGGAAATCCTCTACCGTTGGGGTCTGAGAGAGAAGCGAGCTGAAGTGTTGAAGTTTGTCTCCTGTCCTCCTGACCCTCACAAAGGGATCGAGTTCGGCGTGTACTGCAGCCACTGCCGGAGTGAGGTCCGTGGCACGCAGTGTGCCATCTGCAAAGGCTTCACGTTCCAGTGTGCCATCTGTCACGTGGCTGTGCGGGGATCGTCCAATTTCTGCCTGACCTGTGGGCACGGTGGCCACACCAGCCACATGATGGAGTGGTTTCGGACCCAGGAGGTGTGTCCCACCGGGTGTGGGTGCCACTGCCTGCTTGAAAGCACTTTCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMAARWSSENVVVEFRDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKW DIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDLLVTSSVDTYIYIWDIKDTRKPTVALSAVAGASQVKWNKKN ANCLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDSEHILATSSQDNSVKFWDYRQPRKYLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRE NSLLLWNVFDLNTPVHTFVGHDDVVLEFQWRKQKEGSKDYQLVTWSRDQTLRMWRVDSQMQRLCANDILDGVDEFIESISLLPEPEKTLHTEDTDHQHTA SHGEEEALKEDPPRNLLEERKSDQLGLPQTLQQEFSLINVQIRNVNVEMDAADRSCTVSVHCSNHRVKMLVKFPAQYPNNAAPSFQFINPTTITSTMKAK LLKILKDTALQKVKRGQSCLEPCLRQLVSCLESFVNQEDSASSNPFALPNSVTPPLPTFARVTTAYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMH RAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQIKAAGKVIIQDIACLLPVHK SLGELYILNVNDIQETCQKNAASALLVGRKDLVQVWSLATVATDLCLGPKSDPDLETPWARHPFGRQLLESLLAHYCRLRDVQTLAMLCSVFEAQSRPQG LPNPFGPFPNRSSNLVVSHSRYPSFTSSGSCSSMSDPGLNTGGWNIAGREAEHLSSPWGESSPEELRFGSLTYSDPRERERDQHDKNKRLLDPANTQQFD DFKKCYGEILYRWGLREKRAEVLKFVSCPPDPHKGIEFGVYCSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGHTSHMMEWFRTQEVC PTGCGCHCLLESTF*
Price: £125.00
Completion Time: 
14
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
Ubiquitylation Site: 
Yes
Reagent Type: 

DDB1

cDNA Synonyms: 
DDBA; UV-DDB1; XAP1; XPCE; XPE; XPE-BF
DU Number: 
DU63862
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS DDB1
Expressed: 
3FLAG GSGSGS NLS DDB1
Genbank: 
NM_001923.4 with one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGTCGTACAACTACGTGGTAACGGCCCAGAAGCCCACCGCCGTGAACGGCTGCGTGACCGGACACTTTACTTCGGCCGAAGACTTAAACCTGTTGATTGCCAAAAACACGAGATTAGAGATCTATGTGGTCACCGCCGAGGGGCTTCGGCCCGTCAAAGAGGTGGGCATGTATGGGAAGATTGCGGTCATGGAGCTTTTCAGGCCCAAGGGGGAGAGCAAGGACCTGCTGTTTATCTTGACAGCGAAGTACAATGCCTGCATCCTGGAGTATAAACAGAGTGGCGAGAGCATTGACATCATTACGCGAGCCCATGGCAATGTCCAGGACCGCATTGGCCGCCCCTCAGAGACCGGCATTATTGGCATCATTGACCCTGAGTGCCGGATGATTGGCCTGCGTCTCTATGATGGCCTTTTCAAGGTTATTCCACTAGATCGCGATAATAAAGAACTCAAGGCCTTCAACATCCGCCTGGAGGAGCTGCATGTCATTGATGTCAAGTTCCTATATGGTTGCCAAGCACCTACTATTTGCTTTGTCTACCAGGACCCTCAGGGGCGGCACGTAAAAACCTATGAGGTGTCTCTCCGAGAAAAGGAATTCAATAAGGGCCCTTGGAAACAGGAAAATGTCGAAGCTGAAGCTTCCATGGTGATCGCAGTCCCAGAGCCCTTTGGGGGGGCCATCATCATTGGACAGGAGTCAATCACCTATCACAATGGTGACAAATACCTGGCTATTGCCCCTCCTATCATCAAGCAAAGCACGATTGTGTGCCACAATCGAGTGGACCCTAATGGCTCAAGATACCTGCTGGGAGACATGGAAGGCCGGCTCTTCATGCTGCTTTTGGAGAAGGAGGAACAGATGGATGGCACCGTCACTCTCAAGGATCTCCGTGTAGAACTCCTTGGAGAGACCTCTATTGCTGAGTGCTTGACATACCTTGATAATGGTGTTGTGTTTGTCGGGTCTCGCCTGGGTGACTCCCAGCTTGTGAAGCTCAACGTTGACAGTAATGAACAAGGCTCCTATGTAGTGGCCATGGAAACCTTTACCAACTTAGGACCCATTGTCGATATGTGCGTGGTGGACCTGGAGAGGCAGGGGCAGGGGCAGCTGGTCACTTGCTCTGGGGCTTTCAAGGAAGGTTCTTTGCGGATCATCCGGAATGGAATTGGAATCCACGAGCATGCCAGCATTGACTTACCAGGCATCAAAGGATTATGGCCACTGCGGTCTGACCCTAATCGTGAGACTGATGACACTTTGGTGCTCTCTTTTGTGGGCCAGACAAGAGTTCTCATGTTAAATGGAGAGGAGGTAGAAGAAACCGAACTGATGGGTTTCGTGGATGATCAGCAGACTTTCTTCTGTGGCAACGTGGCTCATCAGCAGCTTATCCAGATCACTTCAGCATCGGTGAGGTTGGTCTCTCAAGAACCCAAAGCTCTGGTCAGTGAATGGAAGGAGCCTCAGGCCAAGAACATCAGTGTGGCCTCCTGCAATAGCAGCCAGGTGGTGGTGGCTGTAGGCAGGGCCCTCTACTATCTGCAGATCCATCCTCAGGAGCTCCGGCAGATCAGCCACACAGAGATGGAACATGAAGTGGCTTGCTTGGACATCACCCCATTAGGAGACAGCAATGGACTGTCCCCTCTTTGTGCCATTGGCCTCTGGACGGACATCTCGGCTCGTATCTTGAAGTTGCCCTCTTTTGAACTACTGCACAAGGAGATGCTGGGTGGAGAGATCATTCCTCGCTCCATCCTGATGACCACCTTTGAGAGTAGCCATTACCTCCTTTGTGCCTTGGGAGATGGAGCGCTTTTCTACTTTGGGCTCAACATTGAGACAGGTCTGTTGAGCGACCGTAAGAAGGTGACTTTGGGCACCCAGCCCACCGTATTGAGGACTTTTCGTTCTCTTTCTACCACCAACGTCTTTGCTTGTTCTGACCGCCCCACTGTCATCTATAGCAGCAACCACAAATTGGTCTTCTCAAATGTCAACCTCAAGGAAGTGAACTACATGTGTCCCCTCAATTCAGATGGCTATCCTGACAGCCTGGCGCTGGCCAACAATAGCACCCTCACCATTGGCACCATCGATGAGATCCAGAAGCTGCACATTCGCACAGTTCCCCTCTATGAGTCTCCAAGGAAGATCTGCTACCAGGAAGTGTCCCAGTGTTTCGGGGTCCTCTCCAGCCGCATTGAAGTCCAAGACACGAGTGGGGGCACGACAGCCTTGAGGCCCAGCGCTAGCACCCAGGCTCTGTCCAGCAGTGTAAGCTCCAGCAAGCTGTTCTCCAGCAGCACTGCTCCTCATGAGACCTCCTTTGGAGAAGAGGTGGAGGTGCACAACCTACTTATCATTGACCAACACACCTTTGAAGTGCTTCATGCCCACCAGTTTCTGCAGAATGAATATGCCCTCAGTCTGGTTTCCTGCAAGCTGGGCAAAGACCCCAACACTTACTTCATTGTGGGCACAGCAATGGTGTATCCTGAAGAGGCAGAGCCCAAGCAGGGTCGCATTGTGGTCTTTCAGTATTCGGATGGAAAACTACAGACTGTGGCTGAAAAGGAAGTGAAAGGGGCCGTGTACTCTATGGTGGAATTTAACGGGAAGCTGTTAGCCAGCATCAATAGCACGGTGCGGCTCTATGAGTGGACAACAGAGAAGGAGCTGCGCACTGAGTGCAACCACTACAACAACATCATGGCCCTCTACCTGAAGACCAAGGGCGACTTCATCCTGGTGGGCGACCTTATGCGCTCAGTGCTGCTGCTTGCCTACAAGCCCATGGAAGGAAACTTTGAAGAGATTGCTCGAGACTTTAATCCCAACTGGATGAGTGCTGTGGAAATCTTGGATGATGACAATTTTCTGGGGGCTGAAAATGCCTTTAACTTGTTTGTGTGTCAAAAGGATAGCGCTGCCACCACTGACGAGGAGCGGCAGCACCTCCAGGAGGTTGGTCTTTTCCACCTGGGCGAGTTTGTCAATGTCTTTTGCCACGGCTCTCTGGTAATGCAGAATCTGGGTGAGACTTCCACCCCCACACAAGGCTCGGTGCTCTTCGGCACGGTCAACGGCATGATAGGGCTGGTGACCTCACTGTCAGAGAGCTGGTACAACCTCCTGCTGGACATGCAGAATCGACTCAATAAAGTCATCAAAAGTGTGGGGAAGATCGAGCACTCCTTCTGGAGATCCTTTCACACCGAGCGGAAGACAGAACCAGCCACAGGTTTCATCGACGGTGACTTGATTGAGAGTTTCCTGGATATTAGCCGCCCCAAGATGCAGGAGGTGGTGGCAAACCTACAGTATGACGATGGCAGCGGTATGAAGCGAGAGGCCACTGCAGACGACCTCATCAAGGTTGTGGAGGAGCTAACTCGGATTCATTAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGK IAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVC HNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIV DMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFC GNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIY SSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQA LSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQT VAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNK VIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH*
Price: £125.00
Completion Time: 
36
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WDR51B

DU Number: 
DU63848
Plasmid: 
pcDNA5D F/T 3FLAG GSGSGS NLS WDR51B
Expressed: 
3FLAG GSGSGS NLS WDR51B
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCCTCAGCCACGGAGGACCCCGTTCTGGAGCGTTATTTCAAAGGCCACAAAGCTGCGATCACCTCCTTGGACCTCAGCCCCAACGGCAAGCAACTTGCTACTGCTTCTTGGGATACCTTTCTCATGCTATGGAATTTCAAGCCACATGCTAGAGCTTACAGATATGTGGGTCACAAGGATGTTGTAACCAGCGTGCAGTTTTCTCCACATGGAAACTTATTGGCGTCTGCCTCACGAGACAGAACCGTGAGACTCTGGATTCCTGATAAGAGAGGAAAATTCTCAGAATTTAAAGCTCATACAGCTCCAGTTCGAAGTGTAGACTTTTCAGCTGATGGCCAGTTTCTAGCTACAGCTTCTGAAGACAAATCCATAAAAGTATGGAGCATGTATCGCCAGCGCTTCCTGTATTCCTTGTATCGACATACACACTGGGTACGCTGTGCCAAATTTTCACCCGATGGAAGACTAATTGTGTCATGTAGTGAGGATAAAACTATTAAAATTTGGGATACCACAAATAAGCAATGTGTTAATAACTTCTCAGATTCCGTTGGATTTGCAAATTTTGTGGACTTTAACCCTAGTGGTACATGCATAGCTTCAGCAGGTTCTGATCAAACTGTGAAAGTCTGGGATGTAAGAGTGAACAAATTACTACAGCATTACCAAGTTCACAGCGGTGGAGTTAATTGCATATCATTCCATCCTTCGGGTAACTATCTCATCACAGCTTCTTCAGATGGTACCCTTAAGATTCTGGACCTCTTAGAAGGAAGGCTCATCTATACACTTCAAGGACATACGGGACCTGTCTTTACTGTTTCATTTTCAAAAGGTGGAGAGCTATTTGCATCAGGAGGTGCAGACACACAGGTCTTATTATGGAGGACTAACTTTGATGAATTGCATTGTAAAGGTCTTACCAAAAGAAATCTCAAAAGATTACATTTTGATTCACCACCACATCTTCTTGATATCTACCCAAGAACACCACATCCCCATGAGGAAAAAGTTGAGACTGTAGAAATTAATCCAAAGCTTGAGGTAATCGATTTGCAGATCTCTACTCCCCCTGTTATGGATATCCTTTCTTTTGATTCTACCACAACAACAGAAACCAGTGGTAGGACTCTGCCAGACAAGGGTGAAGAGGCCTGTGGATATTTCTTGAACCCTTCCTTAATGTCACCAGAATGTTTGCCAACAACCACGAAAAAGAAAACAGAAGACATGAGTGACCTCCCCTGTGAAAGTCAAAGGAGCATACCTCTCGCTGTGACTGATGCTTTAGAGCATATTATGGAACAACTCAATGTTTTGACACAGACTGTTTCAATCTTGGAGCAGCGACTGACTTTGACAGAGGATAAGCTGAAAGACTGCCTTGAAAATCAGCAAAAGCTTTTCAGTGCTGTCCAACAGAAAAGCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMASATEDPVLERYFKGHKAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYRYVGHK DVVTSVQFSPHGNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVRCAKFSPDGRLIV SCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYLITASSDGTLKILDLLEG RLIYTLQGHTGPVFTVSFSKGGELFASGGADTQVLLWRTNFDELHCKGLTKRNLKRLHFDSPPHLLDIYPRTPHPHEEKVETVEINPKLEVIDLQISTPP VMDILSFDSTTTTETSGRTLPDKGEEACGYFLNPSLMSPECLPTTTKKKTEDMSDLPCESQRSIPLAVTDALEHIMEQLNVLTQTVSILEQRLTLTEDKL KDCLENQQKLFSAVQQKS*
Price: £125.00
Completion Time: 
23
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

GRWD1

cDNA Synonyms: 
CDW4; GRWD; RRB1; WDR28
DU Number: 
DU63837
Plasmid: 
pcDNA5D F/T 3FLAG GSGSGS NLS GRWD1
Expressed: 
3FLAG GSGSGS NLS GRWD1
Genbank: 
NM_031485.3 with one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCGGCGCGCAAGGGTCGGCGTCGCACGTGTGAAACCGGGGAACCCATGGAAGCCGAGTCCGGCGACACAAGTTCCGAGGGCCCGGCCCAGGTCTACCTGCCCGGCCGGGGGCCGCCGCTACGCGAAGGGGAGGAGCTGGTCATGGACGAGGAGGCCTATGTGCTCTACCACCGAGCGCAGACTGGCGCCCCCTGTCTCAGCTTTGACATAGTCCGGGATCACCTGGGAGACAACCGGACAGAGCTTCCTCTTACACTTTACTTGTGTGCTGGGACCCAGGCTGAGAGCGCCCAGAGCAACAGACTGATGATGCTTCGGATGCACAATCTGCATGGGACAAAGCCCCCACCCTCAGAGGGCAGTGATGAAGAAGAAGAGGAGGAAGATGAAGAGGATGAAGAAGAGCGGAAACCTCAGCTGGAGCTGGCCATGGTGCCCCACTATGGTGGCATCAACCGAGTTCGGGTGTCATGGCTGGGTGAAGAGCCTGTGGCTGGGGTGTGGTCAGAGAAGGGCCAGGTGGAGGTGTTTGCGCTGCGGCGGCTTCTGCAGGTGGTGGAGGAGCCCCAGGCCCTGGCAGCCTTCCTCCGGGATGAGCAGGCCCAAATGAAGCCCATCTTCTCCTTCGCTGGACACATGGGCGAGGGCTTTGCCCTTGACTGGTCCCCCCGGGTGACCGGTCGCCTGCTGACCGGTGACTGTCAAAAGAACATCCACCTCTGGACACCTACGGACGGCGGCTCCTGGCACGTGGACCAGCGGCCATTCGTGGGCCACACACGCTCTGTGGAGGACCTGCAGTGGTCACCGACTGAGAACACGGTGTTTGCCTCCTGCTCAGCTGACGCCTCCATCCGCATCTGGGACATCCGGGCAGCCCCCAGCAAGGCCTGCATGCTCACCACAGCCACCGCCCATGATGGGGACGTCAATGTCATCAGCTGGAGCCGCCGGGAGCCCTTCCTGCTCAGTGGCGGGGATGATGGGGCCCTCAAGATCTGGGACCTTCGGCAGTTCAAGTCTGGTTCCCCAGTGGCCACCTTCAAGCAGCACGTGGCCCCCGTGACCTCCGTCGAGTGGCACCCCCAGGACAGCGGGGTCTTTGCAGCCTCGGGTGCAGACCACCAGATCACACAGTGGGACCTGGCAGTGGAGCGGGACCCTGAGGCGGGCGACGTGGAGGCCGACCCCGGACTGGCCGACCTCCCGCAGCAGCTGCTGTTCGTGCACCAGGGCGAGACCGAGCTGAAGGAGCTGCACTGGCACCCGCAGTGCCCAGGGCTCCTGGTCAGCACGGCGCTGTCAGGCTTCACCATCTTCCGCACCATCAGCGTCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMAARKGRRRTCETGEPMEAESGDTSSEGPAQVYLPGRGPPLREGEELVMDEEAYVLYHRA QTGAPCLSFDIVRDHLGDNRTELPLTLYLCAGTQAESAQSNRLMMLRMHNLHGTKPPPSEGSDEEEEEEDEEDEEERKPQLELAMVPHYGGINRVRVSWL GEEPVAGVWSEKGQVEVFALRRLLQVVEEPQALAAFLRDEQAQMKPIFSFAGHMGEGFALDWSPRVTGRLLTGDCQKNIHLWTPTDGGSWHVDQRPFVGH TRSVEDLQWSPTENTVFASCSADASIRIWDIRAAPSKACMLTTATAHDGDVNVISWSRREPFLLSGGDDGALKIWDLRQFKSGSPVATFKQHVAPVTSVE WHPQDSGVFAASGADHQITQWDLAVERDPEAGDVEADPGLADLPQQLLFVHQGETELKELHWHPQCPGLLVSTALSGFTIFRTISV*
Price: £125.00
Completion Time: 
31
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

DCAF11

DU Number: 
DU63871
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS DCAF11
Expressed: 
3FLAG GSGSGS NLS DCAF11
Genbank: 
NM_025230.4 with common variant R207H and one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
aGATCTATGGGATCGCGGAACAGCAGCAGTGCAGGATCCGGGTCCGGAGACCCCTCCGAGGGCTTGCCCCGAAGAGGGGCTGGCCTGCGTCGGAGTGAGGAAGAGGAAGAAGAGGATGAAGATGTGGATCTGGCCCAGGTACTGGCCTATCTCCTCCGCAGAGGCCAAGTGAGGTTGGTGCAGGGAGGAGGTGCAGCAAATTTACAATTCATTCAGGCCCTCTTGGACTCAGAGGAAGAGAATGACAGAGCTTGGGATGGTCGTCTTGGGGATCGATACAACCCACCTGTGGATGCTACCCCTGACACCCGGGAGCTGGAATTCAATGAGATCAAGACACAAGTGGAACTGGCCACAGGGCAGCTGGGGCTTAGGCGGGCCGCCCAGAAGCACAGCTTTCCTCGAATGTTGCACCAGAGAGAACGGGGCCTCTGCCATCGGGGAAGCTTCTCCCTTGGAGAACAGTCTCGAGTGATATCTCACTTCTTGCCCAATGATCTGGGCTTCACTGATAGCTACTCTCAGAAGGCTTTCTGTGGCATCTACAGCAAAGATGGTCAAATATTCATGTCTGCTTGCCAAGACCAGACAATCCGACTCTATGACTGCCGATATGGCCGTTTCCATAAATTCAAGAGCATCAAGGCCCGCGATGTAGGCTGGAGCGTCTTGGATGTGGCCTTCACCCCTGATGGGAACCACTTCCTCTACTCTAGCTGGTCTGATTACATTCATATCTGCAATATCTATGGTGAGGGAGATACACACACTGCCCTGGATCTCAGGCCAGATGAGCGTCGCTTTGCTGTCTTCTCCATTGCTGTCTCCTCAGATGGACGAGAAGTACTAGGAGGGGCCAATGATGGCTGCCTGTATGTCTTTGACCGAGAACAGAACCGGCGCACCCTTCAGATTGAGTCCCATGAGGATGATGTGAATGCAGTGGCCTTTGCTGATATAAGCTCCCAAATCCTGTTCTCTGGGGGAGATGATGCCATCTGCAAAGTGTGGGATCGACGCACCATGCGGGAGGATGACCCCAAGCCTGTGGGTGCACTGGCTGGACACCAGGATGGCATCACCTTCATTGACAGCAAGGGTGATGCCCGGTATCTGATCTCCAACTCTAAAGACCAGACCATCAAACTCTGGGATATCCGACGCTTTTCCAGCCGGGAAGGCATGGAAGCTTCACGCCAGGCTGCCACACAGCAAAACTGGGACTATCGGTGGCAGCAAGTGCCCAAAAAAGCCTGGCGGAAGCTGAAGCTCCCAGGGGACAGCTCCTTGATGACCTACCGGGGCCACGGAGTGCTGCACACCCTCATCCGCTGCCGGTTCTCCCCCATTCATAGCACTGGCCAGCAGTTCATCTACAGTGGCTGCTCCACTGGCAAAGTGGTTGTGTACGACCTTCTAAGTGGCCACATTGTGAAGAAGCTGACCAACCACAAGGCCTGTGTGCGTGACGTCAGTTGGCACCCCTTTGAAGAGAAGATTGTCAGCAGTTCGTGGGACGGGAACCTGCGTCTGTGGCAGTACCGCCAGGCTGAGTACTTCCAGGATGACATGCCAGAATCTGAGGAATGTGCCAGCGCCCCTGCCCCAGTGCCCCAATCCTCTACACCCTTTTCCTCACCCCAGTAGGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMGSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLRRGQVRLVQG GGAANLQFIQALLDSEEENDRAWDGRLGDRYNPPVDATPDTRELEFNEIKTQVELATGQLGLRRAAQKHSFPRMLHQRERGLCHRGSFSLGEQSRVISHF LPNDLGFTDSYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFHKFKSIKARDVGWSVLDVAFTPDGNHFLYSSWSDYIHICNIYGEGDTHTALDLR PDERRFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADISSQILFSGGDDAICKVWDRRTMREDDPKPVGALAGHQDGITF IDSKGDARYLISNSKDQTIKLWDIRRFSSREGMEASRQAATQQNWDYRWQQVPKKAWRKLKLPGDSSLMTYRGHGVLHTLIRCRFSPIHSTGQQFIYSGC STGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLWQYRQAEYFQDDMPESEECASAPAPVPQSSTPFSSPQ*
Price: £125.00
Completion Time: 
35
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

DCAF10

cDNA Synonyms: 
WDR32
DU Number: 
DU63873
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS DCAF10
Expressed: 
3FLAG GSGSGS NLS DCAF10
Genbank: 
NM_024345.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGTTTCCCTTTGGGCCCCATAGCCCTGGAGGGGACGGATCGGCCGGAGCCGGGGCTGAGGAGCCGACGCCCCACGAGGGGCAGGCAGCAGCCACCGGGCCGCCCTCGCCACTACATCCCGGGGCTGATGCGACCCATCCCCCTCCACCCGCCCGAAGCCCTCGCCGCCCCGGCGCCCCATCGCTGTCCCCGGCCCCGCGCTCCGGAGAGCTAGGGCTGCCTGGAGCTCCGGAGTCCTCAACTGCCTCCGCCCCGGGAGAGCCGTCACCTCCCTCCCCTCCGTGCCGGCGGCCCGGGCCAGACTGCAGGGCCAAGAGCCGGGGCCGACACGGCCTCGGCGCGGGCCTGGGCGGCCCTGGCGCTAGGCTGTTCGGGTGGCTGAAAGAGCGCAGCCTGGGCCGCGGGCTGTTCGTGGACCCGGCGCGGGACAATTTTCGCACCATGACTAGCCTCTACGGTTCCATCCACCCCGCGGACTCGGTGTACCTCAGCACCCGCACCCACGGCGCCGTCTTCAACCTCGAGTACTCGCCCGACGGGTCAGTGCTGACAGTTGCTTGTGAACAAACTGAAGTTCTGCTTTTTGACCCTATATCTTCAAAGCACATAAAAACACTTTCTGAAGCTCATGAAGACTGTGTAAATAATATCAGATTTCTTGATAACCGGCTGTTTGCTACCTGCTCTGATGACACTACAATAGCACTATGGGATCTGAGAAAATTGAACACCAAAGTATGCACTTTACATGGTCACACTAGCTGGGTGAAGAACATCGAATATGATACTAATACAAGACTCTTAGTAACATCAGGATTTGATGGAAATGTCATTATTTGGGACACTAACAGGTATACAGAAGATGGGTGTCCACATAAGAAATTCTTTCACACACGTTTTCTCATGCGAATGAGGTTAACACCAGATTGTTCCAAAATGTTGATTTCAACGTCCTCTGGATATCTCTTAATTTTGCATGACCTTGACTTAACTAAGTCTTTAGAAGTAGGCAGCTATCCCATTTTAAGAGCAAGAAGAACTACTTCAAGTTCAGATTTGACCACTTCATCAAGTTCATCTGGTCCTAGAGTTTCTGGCTCACCTTGTCATCATAGTGATTCTAATTCTTCTGAGAAACACATGTCACGAGCCTCTCAAAGAGAAGGAGTTTCACCACGAAATAGTCTTGAAGTCGTAACCCCTGAAGTTCTTGGTGAGAGTGACCACGGAAACTGCATCACGTCCTTACAGCTGCACCCAAAAGGCTGGGCCACTCTTCTTCGGTGCTCAAGCAACAGTGATGATGAGGAGTGTACTTGTGTCTATGAATTCCAAGAAGGAGCTCCAGTGCGACCTGTCTCACCTCGCTGTTCTCTACGACTGACTCATTACATTGAAGAAGCCAATGTAGGCAGGGGTTACATCAAAGAACTTTGCTTCAGCCCCGATGGACGAATGATTTCTTCCCCACATGGCTATGGGATTCGCTTGTTGGGATTTGACAAACAGTGCAGTGAACTTGTTGACTGCTTGCCCAAAGAAGCCAGTCCCCTGCGGGTGATCCGTTCTCTGTACTCTCATAATGATGTGGTACTGACAACAAAGTTCTCTCCAACACATTGTCAGATTGCCTCAGGGTGCCTTAGTGGACGGGTTTCTTTGTATCAGCCAAAGTTTTAGGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMFPFGPHSPGGDGSAGAGAEEPTPHEGQAAATGPPSPLHPGADATHPPPPARSPRRPGAP SLSPAPRSGELGLPGAPESSTASAPGEPSPPSPPCRRPGPDCRAKSRGRHGLGAGLGGPGARLFGWLKERSLGRGLFVDPARDNFRTMTSLYGSIHPADS VYLSTRTHGAVFNLEYSPDGSVLTVACEQTEVLLFDPISSKHIKTLSEAHEDCVNNIRFLDNRLFATCSDDTTIALWDLRKLNTKVCTLHGHTSWVKNIE YDTNTRLLVTSGFDGNVIIWDTNRYTEDGCPHKKFFHTRFLMRMRLTPDCSKMLISTSSGYLLILHDLDLTKSLEVGSYPILRARRTTSSSDLTTSSSSS GPRVSGSPCHHSDSNSSEKHMSRASQREGVSPRNSLEVVTPEVLGESDHGNCITSLQLHPKGWATLLRCSSNSDDEECTCVYEFQEGAPVRPVSPRCSLR LTHYIEEANVGRGYIKELCFSPDGRMISSPHGYGIRLLGFDKQCSELVDCLPKEASPLRVIRSLYSHNDVVLTTKFSPTHCQIASGCLSGRVSLYQPKF*
Price: £125.00
Completion Time: 
35
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

DCAF12

cDNA Synonyms: 
CT102; KIAA1892; TCC52; WDR40A
DU Number: 
DU63847
Plasmid: 
pcDNA5D F/T 3FLAG GSGSGS NLS DCAF12
Expressed: 
3FLAG GSGSGS NLS DCAF12
Genbank: 
NM_015397.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
aGATCTGAAACCATGGCCCGGAAAGTAGTTAGCAGGAAGCGGAAAGCGCCCGCCTCGCCGGGAGCTGGGAGCGACGCTCAGGGCCCGCAGTTTGGCTGGGATCACTCGCTTCACAAAAGGAAAAGACTTCCTCCTGTGAAGAGATCCTTAGTATACTACTTGAAGAACCGGGAAGTCAGGCTACAGAATGAAACCAGCTACTCTCGAGTGTTGCATGGTTATGCAGCACAGCAACTTCCCAGTCTCCTGAAGGAGAGAGAGTTTCACCTTGGGACCCTTAATAAAGTGTTTGCATCTCAGTGGTTGAATCATAGGCAAGTGGTGTGTGGCACAAAATGCAACACGCTATTTGTCGTAGATGTCCAGACAAGCCAGATCACCAAGATCCCCATTCTGAAAGACCGGGAGCCTGGAGGTGTGACCCAGCAGGGCTGTGGTATCCATGCCATCGAGCTGAATCCTTCTAGAACACTGCTAGCCACTGGAGGAGACAACCCCAACAGTCTTGCCATCTATCGACTACCTACGCTGGATCCTGTGTGTGTAGGAGATGATGGACACAAGGACTGGATCTTTTCCATCGCATGGATCAGCGACACTATGGCAGTGTCTGGCTCACGTGATGGTTCTATGGGACTCTGGGAGGTGACAGATGATGTTTTGACCAAAAGTGATGCGAGACACAATGTGTCACGGGTCCCTGTGTATGCACACATCACTCACAAGGCCTTAAAGGACATCCCCAAAGAAGACACAAACCCTGACAACTGCAAGGTTCGGGCTCTGGCCTTCAACAACAAGAACAAGGAACTGGGAGCAGTGTCTCTGGATGGCTACTTTCATCTCTGGAAGGCTGAAAATACACTATCTAAGCTCCTCTCCACCAAACTGCCATATTGCCGTGAGAATGTGTGTCTGGCTTATGGTAGTGAATGGTCAGTTTATGCAGTGGGCTCCCAAGCTCATGTCTCCTTCTTGGATCCACGGCAGCCATCATACAACGTCAAGTCTGTCTGTTCCAGGGAGCGAGGCAGTGGAATCCGGTCAGTGAGTTTCTACGAGCACATCATCACTGTGGGAACAGGGCAGGGCTCCCTGCTGTTCTATGACATCCGAGCTCAGAGATTTCTGGAAGAGAGGCTCTCAGCTTGTTATGGGTCCAAGCCCAGACTAGCAGGGGAGAATCTGAAACTAACCACTGGCAAAGGCTGGCTGAATCATGATGAAACCTGGAGGAATTACTTTTCAGACATTGACTTCTTCCCCAATGCTGTTTACACCCACTGCTACGACTCGTCTGGAACGAAACTCTTTGTGGCAGGAGGTCCCCTCCCTTCAGGGCTCCATGGAAACTATGCTGGGCTCTGGAGTTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSETMARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLKNREVRLQ NETSYSRVLHGYAAQQLPSLLKEREFHLGTLNKVFASQWLNHRQVVCGTKCNTLFVVDVQTSQITKIPILKDREPGGVTQQGCGIHAIELNPSRTLLATG GDNPNSLAIYRLPTLDPVCVGDDGHKDWIFSIAWISDTMAVSGSRDGSMGLWEVTDDVLTKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRAL AFNNKNKELGAVSLDGYFHLWKAENTLSKLLSTKLPYCRENVCLAYGSEWSVYAVGSQAHVSFLDPRQPSYNVKSVCSRERGSGIRSVSFYEHIITVGTG QGSLLFYDIRAQRFLEERLSACYGSKPRLAGENLKLTTGKGWLNHDETWRNYFSDIDFFPNAVYTHCYDSSGTKLFVAGGPLPSGLHGNYAGLWS*
Price: £125.00
Completion Time: 
31
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.