3FLAG

CDKL5

cDNA Synonyms: 
EIEE2; ISSX; STK9
DU Number: 
DU67197
Plasmid: 
pBabeD puro 3FLAG TurboID CDKL5 NLS
Expressed: 
3FLAG TurboID CDKL5 NLS
Genbank: 
NM_003159.2 with two silent changes
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
ggatccATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGAGTTGTACTTAAATGCAGACACAAGGAAACACATGAAATTGTGGCGATCAAGAAATTCAAGGACAGTGAAGAAAATGAAGAAGTCAAAGAAACGACTTTACGAGAGCTTAAAATGCTTCGGACTCTCAAGCAGGAAAACATTGTGGAGTTGAAGGAAGCATTTCGTCGGAGGGGAAAGTTGTACTTGGTGTTTGAGTATGTTGAAAAAAATATGCTCGAATTGCTGGAAGAAATGCCAAATGGAGTTCCACCTGAGAAAGTAAAAAGCTACATCTATCAGCTAATCAAGGCTATTCACTGGTGCCATAAGAATGATATTGTCCATCGAGATATAAAACCAGAAAATCTCTTAATCAGCCACAATGATGTCCTAAAACTGTGTGACTTTGGTTTTGCTCGTAATCTGTCAGAAGGCAATAATGCTAATTACACAGAGTACGTTGCCACCAGATGGTATCGGTCCCCAGAACTCTTACTTGGCGCTCCCTATGGAAAGTCCGTGGACATGTGGTCGGTGGGCTGTATTCTTGGGGAGCTTAGCGATGGACAGCCTTTATTTCCTGGAGAAAGTGAAATTGACCAACTTTTTACTATTCAGAAGGTGCTAGGACCACTTCCATCTGAGCAGATGAAGCTTTTCTACAGTAATCCTCGCTTCCATGGGCTCCGGTTTCCAGCTGTTAACCATCCTCAGTCCTTGGAAAGAAGATACCTTGGAATTTTGAATAGTGTTCTACTTGACCTAATGAAGAATTTACTGAAGTTGGACCCAGCTGACAGATACTTGACAGAACAGTGTTTGAATCACCCTACATTTCAAACCCAGAGACTTCTGGATCGTTCTCCTTCAAGGTCAGCAAAAAGAAAACCTTACCATGTGGAAAGCAGCACATTGTCTAATAGAAACCAAGCCGGCAAAAGcACTGCTTTGCAGTCTCACCACAGATCTAACAGCAAGGACATCCAGAACCTGAGTGTAGGCCTGCCCCGGGCTGACGAAGGTCTCCCTGCCAATGAAAGCTTCCTAAATGGAAACCTTGCTGGAGCTAGTCTTAGTCCACTGCACACCAAAACCTACCAAGCAAGCAGCCAGCCTGGGTCTACCAGCAAAGATCTCACCAACAACAACATACCACACCTTCTTAGCCCAAAAGAAGCCAAGTCAAAAACAGAGTTTGATTTTAATATTGACCCAAAGCCTTCAGAAGGCCCAGGGACAAAGTACCTCAAGTCAAACAGCAGATCTCAGCAGAACCGCCACTCATTCATGGAAAGCTCTCAAAGCAAAGCTGGGACACTGCAGCCCAATGAAAAGCAGAGTCGGCATAGCTATATTGACACAATTCCCCAGTCCTCTAGGAGTCCCTCCTACAGGACCAAGGCCAAAAGCCATGGGGCACTGAGTGACTCCAAGTCTGTGAGCAACCTTTCTGAAGCCAGGGCCCAAATTGCGGAGCCCAGTACCAGTAGGTACTTCCCATCTAGCTGCTTAGACTTGAATTCTCCCACCAGCCCAACCCCCACCAGACACAGTGACACGAGAACTTTGCTCAGCCCTTCTGGAAGAAATAACCGAAATGAGGGAACGCTGGACTCACGTCGAACCACAACCAGACATTCTAAGACGATGGAGGAATTGAAGCTGCCGGAGCACATGGACAGTAGCCATTCCCATTCACTGTCTGCACCTCACGAATCTTTTTCTTATGGACTGGGCTACACCAGCCCCTTTTCTTCCCAGCAACGTCCTCATAGGCATTCTATGTATGTGACCCGTGACAAAGTGAGAGCCAAGGGCTTGGATGGAAGCTTGAGCATAGGGCAAGGGATGGCAGCTAGAGCCAACAGCCTGCAACTCTTGTCACCCCAGCCTGGAGAACAGCTCCCTCCAGAGATGACTGTGGCAAGATCTTCGGTCAAAGAGACCTCCAGAGAAGGCACCTCTTCCTTCCATACACGCCAGAAGTCTGAGGGTGGAGTGTATCATGACCCACACTCTGATGATGGCACAGCCCCCAAAGAAAATAGACACCTATACAATGAcCCTGTGCCAAGGAGAGTTGGTAGCTTTTACAGAGTGCCATCTCCACGTCCAGACAATTCTTTCCATGAAAATAATGTGTCAACTAGAGTTTCTTCTCTACCATCAGAGAGCAGTTCTGGAACCAACCACTCAAAAAGACAACCAGCATTCGATCCATGGAAAAGTCCTGAAAATATTAGTCATTCAGAGCAACTCAAGGAAAAAGAGAAGCAAGGATTTTTCAGGTCAATGAAAAAGAAAAAGAAGAAATCTCAAACAGTACCCAATTCCGACAGCCCTGATCTTCTGACGTTGCAGAAATCCATTCATTCTGCTAGCACTCCAAGCAGCAGACCAAAGGAGTGGCGCCCCGAGAAGATCTCAGATCTGCAGACCCAAAGCCAGCCATTAAAATCACTGCGCAAGTTGTTACATCTCTCTTCGGCCTCAAATCACCCGGCTTCCTCAGATCCCCGCTTCCAGCCCTTAACAGCTCAACAAACCAAAAATTCCTTCTCAGAAATTCGGATTCACCCCCTGAGCCAGGCCTCTGGCGGGAGCAGCAACATCCGGCAGGAACCCGCACCGAAGGGCAGGCCAGCCCTCCAGCTGCCAGACGGTGGATGTGATGGCAGAAGACAGAGACACCATTCTGGACCCCAAGATAGACGCTTCATGTTAAGGACGACAGAACAACAAGGAGAATACTTCTGCTGTGGTGACCCAAAGAAGCCTCACACTCCGTGCGTCCCAAACCGAGCCCTTCATCGTCCAATCTCCAGTCCTGCTCCCTATCCAGTACTCCAGGTCCGAGGCACTTCCATGTGCCCGACACTCCAGGTCCGAGGCACTGATGCTTTCAGCTGCCCAACCCAGCAATCCGGGTTCTCTTTCTTCGTGAGACACGTTATGAGGGAAGCCCTGATTCACAGGGCCCAGGTAAACCAAGCTGCGCTCCTGACATACCATGAGAATGCGGCACTGACGGGCAAGCCGAAGAAGAAGCGCAAGGTCTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPEPIPLLNAKQILGQ LDGGSVAVLPVVDSTNQYLLDRIGELKSGDACIAEYQQAGRGSRGRKWFSPFGANLYLSMFWRLKRGPAAIGLGPVIGIVMAEALRKLGADKVRVKWPND LYLQDRKLAGILVELAGITGDAAQIVIGAGINVAMRRVEESVVNQGWITLQEAGINLDRNTLAATLIRELRAALELFEQEGLAPYLPRWEKLDNFINRPV KLIIGDKEIFGISRGIDKQGALLLEQDGVIKPWMGGEISLRSAEKGSMKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEV KETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCD FGFARNLSEGNNANYTEYVATRWYRSPELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYSNPRFHGLRFPAVN HPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQRLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHRSNSKDIQNLSVGL PRADEGLPANESFLNGNLAGASLSPLHTKTYQASSQPGSTSKDLTNNNIPHLLSPKEAKSKTEFDFNIDPKPSEGPGTKYLKSNSRSQQNRHSFMESSQS KAGTLQPNEKQSRHSYIDTIPQSSRSPSYRTKAKSHGALSDSKSVSNLSEARAQIAEPSTSRYFPSSCLDLNSPTSPTPTRHSDTRTLLSPSGRNNRNEG TLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGYTSPFSSQQRPHRHSMYVTRDKVRAKGLDGSLSIGQGMAARANSLQLLSPQPGEQL PPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQ PAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQTQSQPLKSLRKLLHLSSASNHPA SSDPRFQPLTAQQTKNSFSEIRIHPLSQASGGSSNIRQEPAPKGRPALQLPDGGCDGRRQRHHSGPQDRRFMLRTTEQQGEYFCCGDPKKPHTPCVPNRA LHRPISSPAPYPVLQVRGTSMCPTLQVRGTDAFSCPTQQSGFSFFVRHVMREALIHRAQVNQAALLTYHENAALTGKPKKKRKV*
Price: £125.00
Completion Time: 
32
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Skp2

cDNA Synonyms: 
FBL1; FBXL1; FLB1; p45
DU Number: 
DU67041
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS Skp2 (FBXL1) P101A E103A
Expressed: 
3FLAG GSGSGS NLS Skp2 (FBXL1) P101A E103A
Genbank: 
NM_032637.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GCGGCCGCGATGCACAGGAAGCACCTCCAGGAGATTCCAGACCTGAGTAGCAACGTTGCCACCAGCTTCACGTGGGGATGGGATTCCAGCAAGACTTCTGAACTGCTGTCAGGCATGGGGGTCTCCGCCCTGGAGAAAGAGGAGCCCGACAGTGAGAACATCCCCCAGGAACTGCTCTCAAACCTGGGCCACCCGGAGAGCCCCCCACGGAAACGGCTGAAGAGCAAAGGGAGTGACAAAGACTTTGTGATTGTCCGCAGGCCTAAGCTAAATCGAGAGAACTTTCCAGGTGTTTCATGGGACTCCCTTGCCGATGCTCTGCTCTTGGGAATCTTTTCCTGTCTGTGCCTCCCTGAGCTGCTAAAGGTCTCTGGTGTTTGTAAGAGGTGGTATCGCCTAGCGTCTGATGAGTCTCTATGGCAGACCTTAGACCTCACAGGTAAAAATCTGCACCCGGATGTGACTGGTCGGTTGCTGTCTCAAGGGGTGATTGCCTTCCGCTGCCCACGATCATTTATGGACCAACCATTGGCTGAACATTTCAGCCCTTTTCGTGTACAGCACATGGACCTATCGAACTCAGTTATAGAAGTGTCCACCCTCCACGGCATACTGTCTCAGTGTTCCAAGTTGCAGAATCTAAGCCTGGAAGGCCTGCGGCTTTCGGATCCCATTGTCAATACTCTCGCAAAAAACTCAAATTTAGTGCGACTTAACCTTTCTGGGTGTTCTGGATTCTCTGAATTTGCCCTGCAGACTTTGCTAAGCAGCTGTTCCAGACTGGATGAGCTGAACCTCTCCTGGTGTTTTGATTTCACTGAAAAGCATGTACAGGTGGCTGTTGCGCATGTGTCAGAGACCATCACCCAGCTGAATCTTAGCGGCTACAGAAAGAATCTCCAGAAATCAGATCTCTCTACTTTAGTTAGAAGATGCCCCAATCTTGTCCATCTAGACTTAAGTGATAGTGTCATGCTAAAGAATGACTGCTTTCAGGAATTTTTCCAGCTCAACTACCTCCAACACCTATCACTCAGTCGGTGCTATGATATAATACCTGAAACTTTACTATTAGTGACAAGAGCTGGGGTTAGGATCCGGTTGGACTCTGACATCGGATGCCCTCAAACATACAGAACTTCCAAACTCAAGTCCAGCCATAAGCTATTTTGCCAACATGTCAGAGTAATCTGTATTTTTGTATGTGATTTCTACTTTTATAGACTTGTTTTAAAACAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSPGEFASLEKLAAAMHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPD SENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLADALLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNL HPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFA LQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYD IIPETLLLVTRAGVRIRLDSDIGCPQTYRTSKLKSSHKLFCQHVRVICIFVCDFYFYRLVLKQ*
Price: £125.00
Completion Time: 
13
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

DCAF17

cDNA Synonyms: 
C20orf37; C2orf37
DU Number: 
DU67004
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS DCAF17
Expressed: 
3FLAG GSGSGS NLS DCAF17
Genbank: 
NM_025000.3 with 2 silent changes
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
gTCGACGAAACCATGGGCCCGACCCGGAAGCCCAACGTGTGCAGCCGGCTGAGTCGCCGGGCGCTGGGCTGCTTCTCGCGCGACGCAGGCGTGGTGCAGAGGACCAACCTGGGCATCCTGCGGGCGCTGGTGTGCCAGGAAAGTACTAAATTTAAGAATGTTTGGACAACTCATTCCAGGTCACCTATAGCCTATGAGAGAGGAAGAATATATTTTGACAATTATCGGCGCTGTGTCAGCAGTGTTGCATCTGAGCCAAGAAAACTTTATGAAATGCCAAAATGTTCCAAATCAGAAAAAATAGAGGATGCTTTATTATGGGAATGCCCAGTGGGAGATATACTTCCCAATTCATCAGATTATAAGTCCTCACTCATAGCACTGACTGCTCATAATTGGCTACTTCGTATATCAGCAACTACGGGAAAAATCCTTGAGAAAATATATCTTGCACCTTATTGCAAATTCAGATACTTGAGCTGGGACACTCCTCAAGAAGTCATTGCAGTTAAGTCAGCTCAGAACAGAGGCTCAGCAGTGGCCCGGCAGGCAGGCATTCAACAACATGTTTTGCTGTACCTTGCAGTGTTCCGAGTTCTACCTTTTTCACTTGTAGGGATTCTAGAGATCAACAAAAAGATTTTTGGGAACGTTACAGATGCTACCTTGTCTCATGGAATACTGATTGTGATGTACAGCTCAGGACTGGTCAGACTCTATAGCTTCCAAACCATCGCTGAACAGTTCATGCAACAGAAACTTGACTTAGGGTGTGCATGCAGATGGGGTGGGACTACTGGAACTGTAGGAGAGGCTCCTTTTGGCATTCCTTGTAATATTAAAATCACAGACATGCCACCACTGCTCTTTGAGGTGTCATCCCTGGAGAATGCTTTTCAGATTGGAGGCCATCCTTGGCACTACATCGTCACACCTAATAAGAAGAAACAGAAAGGAGTTTTCCATATTTGTGCCCTAAAAGACAATTCCCTGGCAAAAAATGGGATCCAGGAAATGGATTGTTGTTCTCTAGAATCTGACTGGATCTATTTCCATCCTGATGCTTCTGGTAGAATAATACATGTTGGTCCAAATCAAGTCAAAGTTTTGAAGCTAACTGAAATAGAAAATAATAGTTCTCAGCATCAGATCTCTGAAGATTTTGTCATTTTGGCCAACAGGGAGAACCATAAAAATGAAAATGTACTCACTGTTACAGCTTCTGGACGGGTGGTAAAAAAAAGTTTTAACCTTCTGGATGATGACCCAGAACAAGAGACTTTCAAAATTGTGGACTATGAAGATGAGTTAGATTTGCTTTCTGTGGTAGCTGTTACTCAAATAGATGCTGAAGGAAAAGCTCACCTGGATTTCCACTGTAATGAATATGGAACTTTACTTAAAAGCATTCCACTAGTGGAGTCATGGGATGTGACATATAGCCATGAAGTCTACTTTGACAGAGACTTGGTGCTACACATAGAGCAGAAACCCAACAGAGTCTTCAGCTGCTATGTTTACCAGATGATATGTGACACTGGGGAAGAAGAAGAAACCATAAACAGAAGCTGTTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSPGEFASLDETMGPTRKPNVCSRLSRRALGCFSRDAGVVQRTNLGILRALVCQESTKFKNV WTTHSRSPIAYERGRIYFDNYRRCVSSVASEPRKLYEMPKCSKSEKIEDALLWECPVGDILPNSSDYKSSLIALTAHNWLLRISATTGKILEKIYLAPYC KFRYLSWDTPQEVIAVKSAQNRGSAVARQAGIQQHVLLYLAVFRVLPFSLVGILEINKKIFGNVTDATLSHGILIVMYSSGLVRLYSFQTIAEQFMQQKL DLGCACRWGGTTGTVGEAPFGIPCNIKITDMPPLLFEVSSLENAFQIGGHPWHYIVTPNKKKQKGVFHICALKDNSLAKNGIQEMDCCSLESDWIYFHPD ASGRIIHVGPNQVKVLKLTEIENNSSQHQISEDFVILANRENHKNENVLTVTASGRVVKKSFNLLDDDPEQETFKIVDYEDELDLLSVVAVTQIDAEGKA HLDFHCNEYGTLLKSIPLVESWDVTYSHEVYFDRDLVLHIEQKPNRVFSCYVYQMICDTGEEEETINRSC*
Price: £125.00
Completion Time: 
39
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

FBXL7

cDNA Synonyms: 
RT134 F6
DU Number: 
DU63992
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS FBXL7 delta I114-T160
Expressed: 
3FLAG GSGSGS NLS FBXL7 delta I114-T160
Genbank: 
NM_012304.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGGCGCGAACAATGGCAAACAGTACGGCAGTGAGGGCAAAGGCAGCTCGAGCATCTCATCTGACGTGAGTTCAAGTACAGATCACACGCCCACTAAAGCCCAGAAGAATGTGGCTACCAGCGAAGACTCCGACCTGAGCATGCGCACACTGAGCACGCCCAGCCCAGCCCTGATATGTCCACCGAATCTCCCAGGATTTCAGAATGGAAGGGGCTCGTCCACCTCCTCGTCCTCCATCACCGGGGAGACGGTGGCCATGGTGCACTCCCCGCCCCCGACCCGCCTCACACACCCGCTCATCCGGCTCGCCTCCAGACCCCAGAAGGAGCAGGCCAGCGGCGAGACCATCAACGTGGACCGCGCCCTCAAGGTGCTGACCCGCAGACTCTGCCAGGACACCCCCAACGTGTGTCTCATGCTGGAAACCGTAACTGTCAGTGGCTGCAGGCGGCTCACAGACCGAGGGCTGTACACCATCGCCCAGTGCTGCCCCGAACTGAGGCGACTGGAAGTCTCAGGCTGTTACAATATCTCCAACGAGGCCGTCTTTGATGTGGTGTCCCTCTGCCCTAATCTGGAGCACCTGGATGTGTCAGGATGCTCCAAAGTGACCTGCATCAGCTTGACCCGGGAGGCCTCCATTAAACTGTCACCCTTGCATGGCAAACAGATTTCCATCCGCTACCTGGACATGACGGACTGCTTCGTGCTGGAGGACGAAGGCCTGCACACCATCGCGGCGCACTGCACGCAGCTCACCCACCTCTACCTGCGCCGCTGCGTCCGCCTGACCGACGAAGGCCTGCGCTACCTGGTGATCTACTGCGCCTCCATCAAGGAGCTGAGCGTCAGCGACTGCCGCTTCGTCAGCGACTTCGGCCTGCGGGAGATCGCCAAGCTGGAGTCCCGCCTGCGGTACCTGAGCATCGCGCACTGCGGCCGGGTCACCGACGTGGGCATCCGCTACGTGGCCAAGTACTGCAGCAAGCTGCGCTACCTCAACGCGAGGGGCTGCGAGGGCATCACGGACCACGGTGTGGAGTACCTCGCCAAGAACTGCACCAAACTCAAATCCCTGGATATCGGCAAATGCCCTTTGGTATCCGACACGGGCCTGGAGTGCCTGGCCCTGAACTGCTTCAACCTCAAGCGGCTCAGCCTCAAGTCCTGCGAGAGCATCACCGGCCAGGGCTTGCAGATCGTGGCCGCCAACTGCTTTGACCTCCAGACGCTGAATGTCCAGGACTGCGAGGTCTCCGTGGAGGCCCTGCGCTTTGTCAAACGCCACTGCAAGCGCTGCGTCATCGAGCACACCAACCCGGCTTTCTTCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALIC PPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTI AQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRR CVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSL DIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAFF*
Price: £125.00
Completion Time: 
18
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

FBXL7

cDNA Synonyms: 
RT134 F5
DU Number: 
DU63991
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS FBXL7 P118A D119A H120A
Expressed: 
3FLAG GSGSGS NLS FBXL7 P118A D119A H120A
Genbank: 
NM_012304.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGGCGCGAACAATGGCAAACAGTACGGCAGTGAGGGCAAAGGCAGCTCGAGCATCTCATCTGACGTGAGTTCAAGTACAGATCACACGCCCACTAAAGCCCAGAAGAATGTGGCTACCAGCGAAGACTCCGACCTGAGCATGCGCACACTGAGCACGCCCAGCCCAGCCCTGATATGTCCACCGAATCTCCCAGGATTTCAGAATGGAAGGGGCTCGTCCACCTCCTCGTCCTCCATCACCGGGGAGACGGTGGCCATGGTGCACTCCCCGCCCCCGACCCGCCTCACACACCCGCTCATCCGGCTCGCCTCCAGACCCCAGAAGGAGCAGGCCAGCATAGACCGGCTCGCCGCAGCTTCCATGGTGCAGATCTTCTCCTTCCTGCCCACCAACCAGCTGTGCCGCTGCGCGCGAGTGTGCCGCCGCTGGTACAACCTGGCCTGGGACCCGCGGCTCTGGAGGACTATCCGCCTGACGGGCGAGACCATCAACGTGGACCGCGCCCTCAAGGTGCTGACCCGCAGACTCTGCCAGGACACCCCCAACGTGTGTCTCATGCTGGAAACCGTAACTGTCAGTGGCTGCAGGCGGCTCACAGACCGAGGGCTGTACACCATCGCCCAGTGCTGCCCCGAACTGAGGCGACTGGAAGTCTCAGGCTGTTACAATATCTCCAACGAGGCCGTCTTTGATGTGGTGTCCCTCTGCCCTAATCTGGAGCACCTGGATGTGTCAGGATGCTCCAAAGTGACCTGCATCAGCTTGACCCGGGAGGCCTCCATTAAACTGTCACCCTTGCATGGCAAACAGATTTCCATCCGCTACCTGGACATGACGGACTGCTTCGTGCTGGAGGACGAAGGCCTGCACACCATCGCGGCGCACTGCACGCAGCTCACCCACCTCTACCTGCGCCGCTGCGTCCGCCTGACCGACGAAGGCCTGCGCTACCTGGTGATCTACTGCGCCTCCATCAAGGAGCTGAGCGTCAGCGACTGCCGCTTCGTCAGCGACTTCGGCCTGCGGGAGATCGCCAAGCTGGAGTCCCGCCTGCGGTACCTGAGCATCGCGCACTGCGGCCGGGTCACCGACGTGGGCATCCGCTACGTGGCCAAGTACTGCAGCAAGCTGCGCTACCTCAACGCGAGGGGCTGCGAGGGCATCACGGACCACGGTGTGGAGTACCTCGCCAAGAACTGCACCAAACTCAAATCCCTGGATATCGGCAAATGCCCTTTGGTATCCGACACGGGCCTGGAGTGCCTGGCCCTGAACTGCTTCAACCTCAAGCGGCTCAGCCTCAAGTCCTGCGAGAGCATCACCGGCCAGGGCTTGCAGATCGTGGCCGCCAACTGCTTTGACCTCCAGACGCTGAATGTCCAGGACTGCGAGGTCTCCGTGGAGGCCCTGCGCTTTGTCAAACGCCACTGCAAGCGCTGCGTCATCGAGCACACCAACCCGGCTTTCTTCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALIC PPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLAAASMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLT GETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREA SIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHC GRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLN VQDCEVSVEALRFVKRHCKRCVIEHTNPAFF*
Price: £125.00
Completion Time: 
18
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

FBXO16

cDNA Synonyms: 
FBX16
DU Number: 
DU63990
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS FBXO16 delta T89-R135
Expressed: 
3FLAG GSGSGS NLS FBXO16 delta T89-R135
Genbank: 
NM_172366.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGATGGCATTTGCACCTCCAAAAAACACAGATGGTCCCAAAATGCAGACAAAGATGAGCACCTGGACACCCCTAAACCATCAGCTATTGAATGACCGGGTATTTGAAGAAAGAAGAGCCCTGCTTGGCAAATGGTTTGACAAATGGACAGACTCTCAAAGAAGAAGAATCCTCACAGGCCTGTTGGAGCGCTGCTCGCTGTCCCAGCAAAAGTTCTGCTGTCGAAAGCTTCAAGAGAAAATTCCAGCAGAAGCCCTGGACTTTTTTAACTGGTACATCAATTTCTCTCCAACTCCCTTTGAGCAGGGGATCTGGAAGAAGCACTATATTCAAATGGTGAAAGAACTTCATATTACCAAGCCTAAGACACCCCCAAAGGATGGATTTGTAATCGCTGACGTTCAACTAGTTACAAGCAATTCTCCAGAGGAAAAACAGTCCCCTTTATCAGCTTTTCGGTCCTCTTCCTCTTTAAGAAAGAAGAATAACTCAGGGGAGAAAGCACTTCCACCCTGGCGATCTTCTGATAAGCACCCAACAGATATCATTCGTTTTAATTACCTAGACAACCGTGACCCCATGGAGACTGTCCAGCAAGGAAGAAGAAAAAGAAACCAAATGACCCCAGACTTCAGCCGACAGTCACATGATAAGAAAAATAAATTGCAGGACAGAACTAGGCTAAGAAAAGCACAATCAATGATGTCGAGGAGAAATCCCTTCCCACTATGTCCCTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTG LLERCSLSQQKFCCRKLQEKIPAEALDFFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRK KNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP*
Price: £125.00
Completion Time: 
18
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

FBXO16

cDNA Synonyms: 
FBX16
DU Number: 
DU63989
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS FBXO16 P93A R94A V95A
Expressed: 
3FLAG GSGSGS NLS FBXO16 P93A R94A V95A
Genbank: 
NM_172366.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGATGGCATTTGCACCTCCAAAAAACACAGATGGTCCCAAAATGCAGACAAAGATGAGCACCTGGACACCCCTAAACCATCAGCTATTGAATGACCGGGTATTTGAAGAAAGAAGAGCCCTGCTTGGCAAATGGTTTGACAAATGGACAGACTCTCAAAGAAGAAGAATCCTCACAGGCCTGTTGGAGCGCTGCTCGCTGTCCCAGCAAAAGTTCTGCTGTCGAAAGCTTCAAGAGAAAATTCCAGCAGAAGCCCTGGACTTTACAACCAAGCTTGCCGCAGCTTTATCTTTATACATCTTTTCTTTCCTGGACCCTCGGAGCCTTTGTCGTTGTGCACAGGTGTGCTGGCATTGGAAGAACCTTGCTGAGCTGGACCAGCTCTGGATGCTGAAATGTTTACGGTTTAACTGGTACATCAATTTCTCTCCAACTCCCTTTGAGCAGGGGATCTGGAAGAAGCACTATATTCAAATGGTGAAAGAACTTCATATTACCAAGCCTAAGACACCCCCAAAGGATGGATTTGTAATCGCTGACGTTCAACTAGTTACAAGCAATTCTCCAGAGGAAAAACAGTCCCCTTTATCAGCTTTTCGGTCCTCTTCCTCTTTAAGAAAGAAGAATAACTCAGGGGAGAAAGCACTTCCACCCTGGCGATCTTCTGATAAGCACCCAACAGATATCATTCGTTTTAATTACCTAGACAACCGTGACCCCATGGAGACTGTCCAGCAAGGAAGAAGAAAAAGAAACCAAATGACCCCAGACTTCAGCCGACAGTCACATGATAAGAAAAATAAATTGCAGGACAGAACTAGGCTAAGAAAAGCACAATCAATGATGTCGAGGAGAAATCCCTTCCCACTATGTCCCTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTG LLERCSLSQQKFCCRKLQEKIPAEALDFTTKLAAALSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMV KELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSR QSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP*
Price: £125.00
Completion Time: 
18
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Skp2

cDNA Synonyms: 
FBL1; FBXL1; FLB1; p45
DU Number: 
DU63986
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS Skp2 (FBXL1) delta W97-T143
Expressed: 
3FLAG GSGSGS NLS Skp2 (FBXL1) delta W97-T143
Genbank: 
NM_032637.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GCGGCCGCGATGCACAGGAAGCACCTCCAGGAGATTCCAGACCTGAGTAGCAACGTTGCCACCAGCTTCACGTGGGGATGGGATTCCAGCAAGACTTCTGAACTGCTGTCAGGCATGGGGGTCTCCGCCCTGGAGAAAGAGGAGCCCGACAGTGAGAACATCCCCCAGGAACTGCTCTCAAACCTGGGCCACCCGGAGAGCCCCCCACGGAAACGGCTGAAGAGCAAAGGGAGTGACAAAGACTTTGTGATTGTCCGCAGGCCTAAGCTAAATCGAGAGAACTTTCCAGGTGTTTCAGGTAAAAATCTGCACCCGGATGTGACTGGTCGGTTGCTGTCTCAAGGGGTGATTGCCTTCCGCTGCCCACGATCATTTATGGACCAACCATTGGCTGAACATTTCAGCCCTTTTCGTGTACAGCACATGGACCTATCGAACTCAGTTATAGAAGTGTCCACCCTCCACGGCATACTGTCTCAGTGTTCCAAGTTGCAGAATCTAAGCCTGGAAGGCCTGCGGCTTTCGGATCCCATTGTCAATACTCTCGCAAAAAACTCAAATTTAGTGCGACTTAACCTTTCTGGGTGTTCTGGATTCTCTGAATTTGCCCTGCAGACTTTGCTAAGCAGCTGTTCCAGACTGGATGAGCTGAACCTCTCCTGGTGTTTTGATTTCACTGAAAAGCATGTACAGGTGGCTGTTGCGCATGTGTCAGAGACCATCACCCAGCTGAATCTTAGCGGCTACAGAAAGAATCTCCAGAAATCAGATCTCTCTACTTTAGTTAGAAGATGCCCCAATCTTGTCCATCTAGACTTAAGTGATAGTGTCATGCTAAAGAATGACTGCTTTCAGGAATTTTTCCAGCTCAACTACCTCCAACACCTATCACTCAGTCGGTGCTATGATATAATACCTGAAACTTTACTATTAGTGACAAGAGCTGGGGTTAGGATCCGGTTGGACTCTGACATCGGATGCCCTCAAACATACAGAACTTCCAAACTCAAGTCCAGCCATAAGCTATTTTGCCAACATGTCAGAGTAATCTGTATTTTTGTATGTGATTTCTACTTTTATAGACTTGTTTTAAAACAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSPGEFASLEKLAAAMHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPD SENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIE VSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYR KNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLLVTRAGVRIRLDSDIGCPQTYRTSKLKSSHKLFCQHVRVI CIFVCDFYFYRLVLKQ*
Price: £125.00
Completion Time: 
16
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Skp2

cDNA Synonyms: 
FBL1; FBXL1; FLB1; p45
DU Number: 
DU63985
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS Skp2 (FBXL1) P101A S110A
Expressed: 
3FLAG GSGSGS NLS Skp2 (FBXL1) P101A S110A
Genbank: 
NM_032637.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GCGGCCGCGATGCACAGGAAGCACCTCCAGGAGATTCCAGACCTGAGTAGCAACGTTGCCACCAGCTTCACGTGGGGATGGGATTCCAGCAAGACTTCTGAACTGCTGTCAGGCATGGGGGTCTCCGCCCTGGAGAAAGAGGAGCCCGACAGTGAGAACATCCCCCAGGAACTGCTCTCAAACCTGGGCCACCCGGAGAGCCCCCCACGGAAACGGCTGAAGAGCAAAGGGAGTGACAAAGACTTTGTGATTGTCCGCAGGCCTAAGCTAAATCGAGAGAACTTTCCAGGTGTTTCATGGGACTCCCTTGCCGATGAGCTGCTCTTGGGAATCTTTGCTTGTCTGTGCCTCCCTGAGCTGCTAAAGGTCTCTGGTGTTTGTAAGAGGTGGTATCGCCTAGCGTCTGATGAGTCTCTATGGCAGACCTTAGACCTCACAGGTAAAAATCTGCACCCGGATGTGACTGGTCGGTTGCTGTCTCAAGGGGTGATTGCCTTCCGCTGCCCACGATCATTTATGGACCAACCATTGGCTGAACATTTCAGCCCTTTTCGTGTACAGCACATGGACCTATCGAACTCAGTTATAGAAGTGTCCACCCTCCACGGCATACTGTCTCAGTGTTCCAAGTTGCAGAATCTAAGCCTGGAAGGCCTGCGGCTTTCGGATCCCATTGTCAATACTCTCGCAAAAAACTCAAATTTAGTGCGACTTAACCTTTCTGGGTGTTCTGGATTCTCTGAATTTGCCCTGCAGACTTTGCTAAGCAGCTGTTCCAGACTGGATGAGCTGAACCTCTCCTGGTGTTTTGATTTCACTGAAAAGCATGTACAGGTGGCTGTTGCGCATGTGTCAGAGACCATCACCCAGCTGAATCTTAGCGGCTACAGAAAGAATCTCCAGAAATCAGATCTCTCTACTTTAGTTAGAAGATGCCCCAATCTTGTCCATCTAGACTTAAGTGATAGTGTCATGCTAAAGAATGACTGCTTTCAGGAATTTTTCCAGCTCAACTACCTCCAACACCTATCACTCAGTCGGTGCTATGATATAATACCTGAAACTTTACTATTAGTGACAAGAGCTGGGGTTAGGATCCGGTTGGACTCTGACATCGGATGCCCTCAAACATACAGAACTTCCAAACTCAAGTCCAGCCATAAGCTATTTTGCCAACATGTCAGAGTAATCTGTATTTTTGTATGTGATTTCTACTTTTATAGACTTGTTTTAAAACAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSPGEFASLEKLAAAMHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPD SENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLADELLLGIFACLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNL HPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFA LQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYD IIPETLLLVTRAGVRIRLDSDIGCPQTYRTSKLKSSHKLFCQHVRVICIFVCDFYFYRLVLKQ*
Price: £125.00
Completion Time: 
16
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

FBXL7

cDNA Synonyms: 
FBL6; FBL7
DU Number: 
DU63960
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS FBXL7
Expressed: 
3FLAG GSGSGS NLS FBXL7
Genbank: 
NM_012304.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGGCGCGAACAATGGCAAACAGTACGGCAGTGAGGGCAAAGGCAGCTCGAGCATCTCATCTGACGTGAGTTCAAGTACAGATCACACGCCCACTAAAGCCCAGAAGAATGTGGCTACCAGCGAAGACTCCGACCTGAGCATGCGCACACTGAGCACGCCCAGCCCAGCCCTGATATGTCCACCGAATCTCCCAGGATTTCAGAATGGAAGGGGCTCGTCCACCTCCTCGTCCTCCATCACCGGGGAGACGGTGGCCATGGTGCACTCCCCGCCCCCGACCCGCCTCACACACCCGCTCATCCGGCTCGCCTCCAGACCCCAGAAGGAGCAGGCCAGCATAGACCGGCTCCCGGACCACTCCATGGTGCAGATCTTCTCCTTCCTGCCCACCAACCAGCTGTGCCGCTGCGCGCGAGTGTGCCGCCGCTGGTACAACCTGGCCTGGGACCCGCGGCTCTGGAGGACTATCCGCCTGACGGGCGAGACCATCAACGTGGACCGCGCCCTCAAGGTGCTGACCCGCAGACTCTGCCAGGACACCCCCAACGTGTGTCTCATGCTGGAAACCGTAACTGTCAGTGGCTGCAGGCGGCTCACAGACCGAGGGCTGTACACCATCGCCCAGTGCTGCCCCGAACTGAGGCGACTGGAAGTCTCAGGCTGTTACAATATCTCCAACGAGGCCGTCTTTGATGTGGTGTCCCTCTGCCCTAATCTGGAGCACCTGGATGTGTCAGGATGCTCCAAAGTGACCTGCATCAGCTTGACCCGGGAGGCCTCCATTAAACTGTCACCCTTGCATGGCAAACAGATTTCCATCCGCTACCTGGACATGACGGACTGCTTCGTGCTGGAGGACGAAGGCCTGCACACCATCGCGGCGCACTGCACGCAGCTCACCCACCTCTACCTGCGCCGCTGCGTCCGCCTGACCGACGAAGGCCTGCGCTACCTGGTGATCTACTGCGCCTCCATCAAGGAGCTGAGCGTCAGCGACTGCCGCTTCGTCAGCGACTTCGGCCTGCGGGAGATCGCCAAGCTGGAGTCCCGCCTGCGGTACCTGAGCATCGCGCACTGCGGCCGGGTCACCGACGTGGGCATCCGCTACGTGGCCAAGTACTGCAGCAAGCTGCGCTACCTCAACGCGAGGGGCTGCGAGGGCATCACGGACCACGGTGTGGAGTACCTCGCCAAGAACTGCACCAAACTCAAATCCCTGGATATCGGCAAATGCCCTTTGGTATCCGACACGGGCCTGGAGTGCCTGGCCCTGAACTGCTTCAACCTCAAGCGGCTCAGCCTCAAGTCCTGCGAGAGCATCACCGGCCAGGGCTTGCAGATCGTGGCCGCCAACTGCTTTGACCTCCAGACGCTGAATGTCCAGGACTGCGAGGTCTCCGTGGAGGCCCTGCGCTTTGTCAAACGCCACTGCAAGCGCTGCGTCATCGAGCACACCAACCCGGCTTTCTTCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSMGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALIC PPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLT GETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREA SIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHC GRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLN VQDCEVSVEALRFVKRHCKRCVIEHTNPAFF*
Price: £125.00
Completion Time: 
8
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.