3FLAG

USP26

DU Number: 
DU67220
Plasmid: 
pCAGGS puro 3FLAG USP26 C304S
Expressed: 
3FLAG USP26 C304S
Genbank: 
NM_031907.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTGCCCTATTCCTACGTGGTTTTGTCCAAATAGGGAACTGCAAGACTGGGATATCTAAGTCAAAAGAAGCATTCATTGAAGCAGTGGAAAGAAAGAAGAAAGATAGACTGGTGCTGTATTTCAAAAGTGGAAAATATAGCACTTTTCGGCTAAGTGATAATATTCAAAATGTAGTCCTTAAATCCTATAGAGGAAACCAAAATCACCTGCATTTAACTTTACAAAATAATAATGGCTTGTTTATTGAAGGATTATCCTCCACAGATGCTGAACAATTGAAGATATTCTTGGACAGAGTTCATCAAAACGAGGTTCAGCCACCTGTGAGACCTGGTAAGGGTGGGAGTGTCTTTTCTAGCACAACACAGAAGGAAATCAACAAAACTTCATTCCACAAAGTTGATGAGAAATCAAGTAGCAAATCTTTTGAGATAGCAAAAGGAAGTGGGACAGGTGTCCTTCAGAGGATGCCTTTGCTTACATCAAAATTGACACTTACTTGCGGAGAGTTATCAGAAAATCAGCACAAGAAGAGGAAAAGAATGCTCTCATCTAGCTCAGAGATGAATGAGGAATTCTTGAAAGAAAATAATTCTGTAGAATACAAGAAATCCAAGGCAGATTGTTCGAGGTGTGTAAGCTATAATCGAGAGAAACAATTGAAGTTAAAAGAGTTAGAAGAGAATAAGAAATTGGAATGTGAATCTTCATGCATCATGAACGCCACTGGAAATCCTTACCTAGATGACATTGGTCTTCTCCAAGCTCTCACTGAGAAAATGGTTTTGGTATTTCTGTTACAACAAGGGTATAGTGACGGTTACACAAAGTGGGATAAATTAAAACTATTTTTTGAATTATTTCCAGAGAAAATATGCCACGGCCTCCCCAATTTGGGAAACACCTCTTATATGAATGCAGTGTTACAGTCTCTACTTTCAATCCCATCGTTTGCTGATGATTTACTTAATCAGAGTTTCCCATGGGGTAAAATTCCCCTTAATGCTCTTACCATGTGCTTGGCACGGCTACTTTTTTTTAAAGATACCTATAATATAGAAATCAAGGAGATGTTACTCTTGAATCTTAAAAAGGCCATTTCAGCAGCTGCAGAGATATTCCATGGCAATGCACAGAACGATGCTCATGAGTTTTTAGCTCACTGTTTAGATCAACTGAAAGATAACATGGAAAAACTCAACACAATTTGGAAGCCTAAAAGTGAATTTGGGGAAGATAATTTTCCTAAACAGGTTTTTGCTGATGATCCTGACACCAGTGGGTTTTCTTGCCCTGTCATTACTAATTTTGAGTTAGAGTTGTTGCACTCCATTGCTTGTAAAGCTTGTGGTCAGGTTATTCTCAAGACAGAACTGAATAATTACCTCTCCATCAACCTTCCCCAAAGAATAAAAGCACATCCTTCATCTATTCAGTCTACTTTTGATCTTTTTTTTGGAGCAGAAGAGCTTGAGTATAAATGTGCAAAATGTGAGCACAAGACTTCCGTTGGAGTGCACTCATTCAGTAGGCTACCTAGAATCCTTATTGTTCACCTCAAACGCTATAGCTTGAATGAGTTTTGTGCATTAAAGAAGAATGACCAGGAAGTCATCATTTCCAAATATTTAAAGGTGTCTTCTCATTGCAATGAAGGCACCAGACCACCTCTTCCCTTGAGTGAGGATGGAGAAATTACAGATTTCCAATTATTAAAAGTTATTCGAAAGATGACTTCTGGAAACATCAGTGTATCATGGCCTGCAACAAAGGAATCCAAAGATATCCTGGCTCCACACATTGGATCAGATAAGGAGTCTGAACAAAAAAAAGGCCAGACAGTCTTTAAAGGGGCAAGCAGAAGACAGCAGCAAAAGTACCTTGGAAAAAATTCTAAACCAAATGAGCTAGAATCTGTATACTCAGGAGATCGAGCATTCATTGAAAAAGAACCGTTAGCTCACTTAATGACGTATCTGGAAGATACCTCACTTTGTCAGTTCCACAAAGCTGGAGGTAAACCTGCCAGCAGCCCAGGCACACCTCTCTCAAAAGTTGACTTTCAAACAGTGCCCGAAAATCCAAAACGAAAGAAATATGTGAAAACCAGTAAGTTTGTAGCTTTTGATAGGATTATCAATCCTACTAAAGATTTGTATGAAGATAAAAATATCAGAATTCCAGAAAGATTCCAAAAAGTGTCTGAACAGACTCAGCAGTGTGACGGTATGAGAATCTGTGAACAAGCCCCTCAGCAGGCACTGCCTCAAAGCTTTCCAAAGCCAGGCACCCAGGGGCACACAAAGAACCTCCTAAGACCTACAAAATTAAATCTACAGAAGTCTAACAGGAATTCCCTACTTGCACTGGGTTCCAATAAGAATCCAAGAAACAAAGACATTTTAGATAAGATAAAATCTAAAGCCAAGGAAACAAAAAGAAATGATGATAAGGGAGATCATACCTACCGGCTCATTAGTGTTGTCAGCCATCTTGGGAAGACTCTAAAGTCAGGCCATTATATCTGTGATGCCTATGACTTTGAGAAACAGATCTGGTTCACTTACGATGATATGCGGGTGTTAGGTATCCAGGAGGCCCAGATGCAGGAGGATAGGCGTTGCACTGGGTACATCTTCTTTTACATGCATAATGAGATCTTTGAAGAGATGTTGAAAAGAGAAGAGAATGCCCAGCTTAATAGCAAGGAGGTAGAGGAGACCCTTCAGAAGGAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTL QNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFSSTTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGVLQRMPLLTSKLTLTCGELSEN QHKKRKRMLSSSSEMNEEFLKENNSVEYKKSKADCSRCVSYNREKQLKLKELEENKKLECESSCIMNATGNPYLDDIGLLQALTEKMVLVFLLQQGYSDG YTKWDKLKLFFELFPEKICHGLPNLGNTSYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKDTYNIEIKEMLLLNLKKAISAAAEIF HGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQVFADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAH PSSIQSTFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKV IRKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGK PASSPGTPLSKVDFQTVPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP TKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRR CTGYIFFYMHNEIFEEMLKREENAQLNSKEVEETLQKE*
Price: £125.00
Completion Time: 
17
Research Area: 
Diseases: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
Ubiquitylation Site: 
Yes
Reagent Type: 

USP26

DU Number: 
DU67219
Plasmid: 
pCAGGS puro 3FLAG USP26 N695K
Expressed: 
3FLAG USP26 N695K
Genbank: 
NM_031907.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTGCCCTATTCCTACGTGGTTTTGTCCAAATAGGGAACTGCAAGACTGGGATATCTAAGTCAAAAGAAGCATTCATTGAAGCAGTGGAAAGAAAGAAGAAAGATAGACTGGTGCTGTATTTCAAAAGTGGAAAATATAGCACTTTTCGGCTAAGTGATAATATTCAAAATGTAGTCCTTAAATCCTATAGAGGAAACCAAAATCACCTGCATTTAACTTTACAAAATAATAATGGCTTGTTTATTGAAGGATTATCCTCCACAGATGCTGAACAATTGAAGATATTCTTGGACAGAGTTCATCAAAACGAGGTTCAGCCACCTGTGAGACCTGGTAAGGGTGGGAGTGTCTTTTCTAGCACAACACAGAAGGAAATCAACAAAACTTCATTCCACAAAGTTGATGAGAAATCAAGTAGCAAATCTTTTGAGATAGCAAAAGGAAGTGGGACAGGTGTCCTTCAGAGGATGCCTTTGCTTACATCAAAATTGACACTTACTTGCGGAGAGTTATCAGAAAATCAGCACAAGAAGAGGAAAAGAATGCTCTCATCTAGCTCAGAGATGAATGAGGAATTCTTGAAAGAAAATAATTCTGTAGAATACAAGAAATCCAAGGCAGATTGTTCGAGGTGTGTAAGCTATAATCGAGAGAAACAATTGAAGTTAAAAGAGTTAGAAGAGAATAAGAAATTGGAATGTGAATCTTCATGCATCATGAACGCCACTGGAAATCCTTACCTAGATGACATTGGTCTTCTCCAAGCTCTCACTGAGAAAATGGTTTTGGTATTTCTGTTACAACAAGGGTATAGTGACGGTTACACAAAGTGGGATAAATTAAAACTATTTTTTGAATTATTTCCAGAGAAAATATGCCACGGCCTCCCCAATTTGGGAAACACCTGTTATATGAATGCAGTGTTACAGTCTCTACTTTCAATCCCATCGTTTGCTGATGATTTACTTAATCAGAGTTTCCCATGGGGTAAAATTCCCCTTAATGCTCTTACCATGTGCTTGGCACGGCTACTTTTTTTTAAAGATACCTATAATATAGAAATCAAGGAGATGTTACTCTTGAATCTTAAAAAGGCCATTTCAGCAGCTGCAGAGATATTCCATGGCAATGCACAGAACGATGCTCATGAGTTTTTAGCTCACTGTTTAGATCAACTGAAAGATAACATGGAAAAACTCAACACAATTTGGAAGCCTAAAAGTGAATTTGGGGAAGATAATTTTCCTAAACAGGTTTTTGCTGATGATCCTGACACCAGTGGGTTTTCTTGCCCTGTCATTACTAATTTTGAGTTAGAGTTGTTGCACTCCATTGCTTGTAAAGCTTGTGGTCAGGTTATTCTCAAGACAGAACTGAATAATTACCTCTCCATCAACCTTCCCCAAAGAATAAAAGCACATCCTTCATCTATTCAGTCTACTTTTGATCTTTTTTTTGGAGCAGAAGAGCTTGAGTATAAATGTGCAAAATGTGAGCACAAGACTTCCGTTGGAGTGCACTCATTCAGTAGGCTACCTAGAATCCTTATTGTTCACCTCAAACGCTATAGCTTGAATGAGTTTTGTGCATTAAAGAAGAATGACCAGGAAGTCATCATTTCCAAATATTTAAAGGTGTCTTCTCATTGCAATGAAGGCACCAGACCACCTCTTCCCTTGAGTGAGGATGGAGAAATTACAGATTTCCAATTATTAAAAGTTATTCGAAAGATGACTTCTGGAAACATCAGTGTATCATGGCCTGCAACAAAGGAATCCAAAGATATCCTGGCTCCACACATTGGATCAGATAAGGAGTCTGAACAAAAAAAAGGCCAGACAGTCTTTAAAGGGGCAAGCAGAAGACAGCAGCAAAAGTACCTTGGAAAAAATTCTAAACCAAATGAGCTAGAATCTGTATACTCAGGAGATCGAGCATTCATTGAAAAAGAACCGTTAGCTCACTTAATGACGTATCTGGAAGATACCTCACTTTGTCAGTTCCACAAAGCTGGAGGTAAACCTGCCAGCAGCCCAGGCACACCTCTCTCAAAAGTTGACTTTCAAACAGTGCCCGAAAAGCCAAAACGAAAGAAATATGTGAAAACCAGTAAGTTTGTAGCTTTTGATAGGATTATCAATCCTACTAAAGATTTGTATGAAGATAAAAATATCAGAATTCCAGAAAGATTCCAAAAAGTGTCTGAACAGACTCAGCAGTGTGACGGTATGAGAATCTGTGAACAAGCCCCTCAGCAGGCACTGCCTCAAAGCTTTCCAAAGCCAGGCACCCAGGGGCACACAAAGAACCTCCTAAGACCTACAAAATTAAATCTACAGAAGTCTAACAGGAATTCCCTACTTGCACTGGGTTCCAATAAGAATCCAAGAAACAAAGACATTTTAGATAAGATAAAATCTAAAGCCAAGGAAACAAAAAGAAATGATGATAAGGGAGATCATACCTACCGGCTCATTAGTGTTGTCAGCCATCTTGGGAAGACTCTAAAGTCAGGCCATTATATCTGTGATGCCTATGACTTTGAGAAACAGATCTGGTTCACTTACGATGATATGCGGGTGTTAGGTATCCAGGAGGCCCAGATGCAGGAGGATAGGCGTTGCACTGGGTACATCTTCTTTTACATGCATAATGAGATCTTTGAAGAGATGTTGAAAAGAGAAGAGAATGCCCAGCTTAATAGCAAGGAGGTAGAGGAGACCCTTCAGAAGGAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTL QNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFSSTTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGVLQRMPLLTSKLTLTCGELSEN QHKKRKRMLSSSSEMNEEFLKENNSVEYKKSKADCSRCVSYNREKQLKLKELEENKKLECESSCIMNATGNPYLDDIGLLQALTEKMVLVFLLQQGYSDG YTKWDKLKLFFELFPEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKDTYNIEIKEMLLLNLKKAISAAAEIF HGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQVFADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAH PSSIQSTFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKV IRKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGK PASSPGTPLSKVDFQTVPEKPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP TKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRR CTGYIFFYMHNEIFEEMLKREENAQLNSKEVEETLQKE*
Price: £125.00
Completion Time: 
17
Research Area: 
Diseases: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
Ubiquitylation Site: 
Yes
Reagent Type: 

USP26

DU Number: 
DU67207
Plasmid: 
pCAGGS puro 3FLAG USP26
Expressed: 
3FLAG USP26
Genbank: 
NM_031907.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTGCCCTATTCCTACGTGGTTTTGTCCAAATAGGGAACTGCAAGACTGGGATATCTAAGTCAAAAGAAGCATTCATTGAAGCAGTGGAAAGAAAGAAGAAAGATAGACTGGTGCTGTATTTCAAAAGTGGAAAATATAGCACTTTTCGGCTAAGTGATAATATTCAAAATGTAGTCCTTAAATCCTATAGAGGAAACCAAAATCACCTGCATTTAACTTTACAAAATAATAATGGCTTGTTTATTGAAGGATTATCCTCCACAGATGCTGAACAATTGAAGATATTCTTGGACAGAGTTCATCAAAACGAGGTTCAGCCACCTGTGAGACCTGGTAAGGGTGGGAGTGTCTTTTCTAGCACAACACAGAAGGAAATCAACAAAACTTCATTCCACAAAGTTGATGAGAAATCAAGTAGCAAATCTTTTGAGATAGCAAAAGGAAGTGGGACAGGTGTCCTTCAGAGGATGCCTTTGCTTACATCAAAATTGACACTTACTTGCGGAGAGTTATCAGAAAATCAGCACAAGAAGAGGAAAAGAATGCTCTCATCTAGCTCAGAGATGAATGAGGAATTCTTGAAAGAAAATAATTCTGTAGAATACAAGAAATCCAAGGCAGATTGTTCGAGGTGTGTAAGCTATAATCGAGAGAAACAATTGAAGTTAAAAGAGTTAGAAGAGAATAAGAAATTGGAATGTGAATCTTCATGCATCATGAACGCCACTGGAAATCCTTACCTAGATGACATTGGTCTTCTCCAAGCTCTCACTGAGAAAATGGTTTTGGTATTTCTGTTACAACAAGGGTATAGTGACGGTTACACAAAGTGGGATAAATTAAAACTATTTTTTGAATTATTTCCAGAGAAAATATGCCACGGCCTCCCCAATTTGGGAAACACCTGTTATATGAATGCAGTGTTACAGTCTCTACTTTCAATCCCATCGTTTGCTGATGATTTACTTAATCAGAGTTTCCCATGGGGTAAAATTCCCCTTAATGCTCTTACCATGTGCTTGGCACGGCTACTTTTTTTTAAAGATACCTATAATATAGAAATCAAGGAGATGTTACTCTTGAATCTTAAAAAGGCCATTTCAGCAGCTGCAGAGATATTCCATGGCAATGCACAGAACGATGCTCATGAGTTTTTAGCTCACTGTTTAGATCAACTGAAAGATAACATGGAAAAACTCAACACAATTTGGAAGCCTAAAAGTGAATTTGGGGAAGATAATTTTCCTAAACAGGTTTTTGCTGATGATCCTGACACCAGTGGGTTTTCTTGCCCTGTCATTACTAATTTTGAGTTAGAGTTGTTGCACTCCATTGCTTGTAAAGCTTGTGGTCAGGTTATTCTCAAGACAGAACTGAATAATTACCTCTCCATCAACCTTCCCCAAAGAATAAAAGCACATCCTTCATCTATTCAGTCTACTTTTGATCTTTTTTTTGGAGCAGAAGAGCTTGAGTATAAATGTGCAAAATGTGAGCACAAGACTTCCGTTGGAGTGCACTCATTCAGTAGGCTACCTAGAATCCTTATTGTTCACCTCAAACGCTATAGCTTGAATGAGTTTTGTGCATTAAAGAAGAATGACCAGGAAGTCATCATTTCCAAATATTTAAAGGTGTCTTCTCATTGCAATGAAGGCACCAGACCACCTCTTCCCTTGAGTGAGGATGGAGAAATTACAGATTTCCAATTATTAAAAGTTATTCGAAAGATGACTTCTGGAAACATCAGTGTATCATGGCCTGCAACAAAGGAATCCAAAGATATCCTGGCTCCACACATTGGATCAGATAAGGAGTCTGAACAAAAAAAAGGCCAGACAGTCTTTAAAGGGGCAAGCAGAAGACAGCAGCAAAAGTACCTTGGAAAAAATTCTAAACCAAATGAGCTAGAATCTGTATACTCAGGAGATCGAGCATTCATTGAAAAAGAACCGTTAGCTCACTTAATGACGTATCTGGAAGATACCTCACTTTGTCAGTTCCACAAAGCTGGAGGTAAACCTGCCAGCAGCCCAGGCACACCTCTCTCAAAAGTTGACTTTCAAACAGTGCCCGAAAATCCAAAACGAAAGAAATATGTGAAAACCAGTAAGTTTGTAGCTTTTGATAGGATTATCAATCCTACTAAAGATTTGTATGAAGATAAAAATATCAGAATTCCAGAAAGATTCCAAAAAGTGTCTGAACAGACTCAGCAGTGTGACGGTATGAGAATCTGTGAACAAGCCCCTCAGCAGGCACTGCCTCAAAGCTTTCCAAAGCCAGGCACCCAGGGGCACACAAAGAACCTCCTAAGACCTACAAAATTAAATCTACAGAAGTCTAACAGGAATTCCCTACTTGCACTGGGTTCCAATAAGAATCCAAGAAACAAAGACATTTTAGATAAGATAAAATCTAAAGCCAAGGAAACAAAAAGAAATGATGATAAGGGAGATCATACCTACCGGCTCATTAGTGTTGTCAGCCATCTTGGGAAGACTCTAAAGTCAGGCCATTATATCTGTGATGCCTATGACTTTGAGAAACAGATCTGGTTCACTTACGATGATATGCGGGTGTTAGGTATCCAGGAGGCCCAGATGCAGGAGGATAGGCGTTGCACTGGGTACATCTTCTTTTACATGCATAATGAGATCTTTGAAGAGATGTTGAAAAGAGAAGAGAATGCCCAGCTTAATAGCAAGGAGGTAGAGGAGACCCTTCAGAAGGAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTL QNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFSSTTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGVLQRMPLLTSKLTLTCGELSEN QHKKRKRMLSSSSEMNEEFLKENNSVEYKKSKADCSRCVSYNREKQLKLKELEENKKLECESSCIMNATGNPYLDDIGLLQALTEKMVLVFLLQQGYSDG YTKWDKLKLFFELFPEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKDTYNIEIKEMLLLNLKKAISAAAEIF HGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQVFADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAH PSSIQSTFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKV IRKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGK PASSPGTPLSKVDFQTVPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP TKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRR CTGYIFFYMHNEIFEEMLKREENAQLNSKEVEETLQKE*
Price: £125.00
Completion Time: 
11
Research Area: 
Diseases: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
Ubiquitylation Site: 
Yes
Reagent Type: 

MPLKIP

cDNA Synonyms: 
TTDN1; ABHS; C7orf11; ORF20; TTD4
DU Number: 
DU67232
Plasmid: 
pcDNA5 FRT/TO 3FLAG MPLKIP
Expressed: 
3FLAG MPLKIP
Genbank: 
NM_138701.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCAGCGACAGAATTTTCGGCCCCCAACTCCTCCTTACCCTGGTCCGGGTGGAGGAGGTTGGGGTAGCGGAAGCAGCTTCCGGGGAACCCCGGGCGGGGGCGGACCACGGCCGCCCTCCCCTCGAGACGGGTACGGGAGTCCGCACCACACGCCGCCGTACGGGCCCCGGTCTAGGCCGTACGGGAGCAGTCACTCTCCGCGACACGGCGGCAGCTTCCCGGGGGGCCGGTTCGGGTCTCCGTCCCCTGGCGGCTACCCTGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCAGCAATTCGGCTACTCCCCAGGGCAGCAGCAGACCCACCCCCAGGGTTCTCCAAGGACATCTACACCATTTGGATCAGGGCGTGTTAGAGAAAAAAGAATGTCTAATGAGTTGGAAAATTATTTCAAGCCTTCAATGCTTGAAGATCCTTGGGCTGGCCTAGAACCAGTATCTGTAGTGGATATAAGCCAACAATACAGCAATACTCAAACATTCACAGGCAAAAAAGGAAGATACTTTTGTTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGG SFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFT GKKGRYFC*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
PMID: 
rouse-CDKL5-paper-3

S100a10 (mouse)

cDNA Synonyms: 
42C; p10; p11; CAL12; CLP11; Cal1l; AA409961; AL024248
DU Number: 
DU61134
Plasmid: 
pCAGGSD puro S100a10 3FLAG mouse
Expressed: 
S100a10 3FLAG mouse
Genbank: 
NM_009112.2
Species: 
Mouse
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCCATCCCAAATGGAGCACGCCATGGAAACCATGATGCTTACGTTTCACAGGTTTGCAGGCGACAAAGACCACTTGACAAAGGAGGACCTGAGAGTGCTCATGGAACGGGAGTTCCCTGGGTTTTTGGAAAATCAAAAGGACCCTCTGGCTGTGGACAAAATAATGAAGGACCTGGACCAGTGCCGAGATGGCAAAGTGGGCTTCCAGAGCTTTCTATCACTAGTGGCAGGGCTCACCATTGCATGCAATGACTATTTTGTAGTAAACATGAAGCAGAAGGGGAAGAAGGACTACAAAGACCATGACGGTGATTATAAAGATCATGATATCGATTACAAGGATGACGATGACAAGTGAGCGGCCGC
Amino Acid Sequence: 
MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKKDYK DHDGDYKDHDIDYKDDDDK*
Price: £125.00
Completion Time: 
12
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
355.050758.D101
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

S100a10 (mouse)

cDNA Synonyms: 
42C; p10; p11; CAL12; CLP11; Cal1l; AA409961; AL024248
DU Number: 
DU61138
Plasmid: 
pCAGGS puro mouse 3FLAG S100a10
Expressed: 
3FLAG mouse S100a10
Genbank: 
NM_009112.2
Species: 
Mouse
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCCATCCCAAATGGAGCACGCCATGGAAACCATGATGCTTACGTTTCACAGGTTTGCAGGCGACAAAGACCACTTGACAAAGGAGGACCTGAGAGTGCTCATGGAACGGGAGTTCCCTGGGTTTTTGGAAAATCAAAAGGACCCTCTGGCTGTGGACAAAATAATGAAGGACCTGGACCAGTGCCGAGATGGCAAAGTGGGCTTCCAGAGCTTTCTATCACTAGTGGCAGGGCTCACCATTGCATGCAATGACTATTTTGTAGTAAACATGAAGCAGAAGGGGAAGAAGTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSL VAGLTIACNDYFVVNMKQKGKK*
Price: £125.00
Completion Time: 
17
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
355.050758.D101
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

CDKL5

cDNA Synonyms: 
EIEE2; ISSX; STK9
DU Number: 
DU67196
Plasmid: 
pBabeD puro 3FLAG TurboID CDKL5 K42R NLS
Expressed: 
3FLAG TurboID CDKL5 K42R NLS
Genbank: 
NM_003159.2 with two silent changes
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
ggatccATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGAGTTGTACTTAAATGCAGACACAAGGAAACACATGAAATTGTGGCGATCcgGAAATTCAAGGACAGTGAAGAAAATGAAGAAGTCAAAGAAACGACTTTACGAGAGCTTAAAATGCTTCGGACTCTCAAGCAGGAAAACATTGTGGAGTTGAAGGAAGCATTTCGTCGGAGGGGAAAGTTGTACTTGGTGTTTGAGTATGTTGAAAAAAATATGCTCGAATTGCTGGAAGAAATGCCAAATGGAGTTCCACCTGAGAAAGTAAAAAGCTACATCTATCAGCTAATCAAGGCTATTCACTGGTGCCATAAGAATGATATTGTCCATCGAGATATAAAACCAGAAAATCTCTTAATCAGCCACAATGATGTCCTAAAACTGTGTGACTTTGGTTTTGCTCGTAATCTGTCAGAAGGCAATAATGCTAATTACACAGAGTACGTTGCCACCAGATGGTATCGGTCCCCAGAACTCTTACTTGGCGCTCCCTATGGAAAGTCCGTGGACATGTGGTCGGTGGGCTGTATTCTTGGGGAGCTTAGCGATGGACAGCCTTTATTTCCTGGAGAAAGTGAAATTGACCAACTTTTTACTATTCAGAAGGTGCTAGGACCACTTCCATCTGAGCAGATGAAGCTTTTCTACAGTAATCCTCGCTTCCATGGGCTCCGGTTTCCAGCTGTTAACCATCCTCAGTCCTTGGAAAGAAGATACCTTGGAATTTTGAATAGTGTTCTACTTGACCTAATGAAGAATTTACTGAAGTTGGACCCAGCTGACAGATACTTGACAGAACAGTGTTTGAATCACCCTACATTTCAAACCCAGAGACTTCTGGATCGTTCTCCTTCAAGGTCAGCAAAAAGAAAACCTTACCATGTGGAAAGCAGCACATTGTCTAATAGAAACCAAGCCGGCAAAAGcACTGCTTTGCAGTCTCACCACAGATCTAACAGCAAGGACATCCAGAACCTGAGTGTAGGCCTGCCCCGGGCTGACGAAGGTCTCCCTGCCAATGAAAGCTTCCTAAATGGAAACCTTGCTGGAGCTAGTCTTAGTCCACTGCACACCAAAACCTACCAAGCAAGCAGCCAGCCTGGGTCTACCAGCAAAGATCTCACCAACAACAACATACCACACCTTCTTAGCCCAAAAGAAGCCAAGTCAAAAACAGAGTTTGATTTTAATATTGACCCAAAGCCTTCAGAAGGCCCAGGGACAAAGTACCTCAAGTCAAACAGCAGATCTCAGCAGAACCGCCACTCATTCATGGAAAGCTCTCAAAGCAAAGCTGGGACACTGCAGCCCAATGAAAAGCAGAGTCGGCATAGCTATATTGACACAATTCCCCAGTCCTCTAGGAGTCCCTCCTACAGGACCAAGGCCAAAAGCCATGGGGCACTGAGTGACTCCAAGTCTGTGAGCAACCTTTCTGAAGCCAGGGCCCAAATTGCGGAGCCCAGTACCAGTAGGTACTTCCCATCTAGCTGCTTAGACTTGAATTCTCCCACCAGCCCAACCCCCACCAGACACAGTGACACGAGAACTTTGCTCAGCCCTTCTGGAAGAAATAACCGAAATGAGGGAACGCTGGACTCACGTCGAACCACAACCAGACATTCTAAGACGATGGAGGAATTGAAGCTGCCGGAGCACATGGACAGTAGCCATTCCCATTCACTGTCTGCACCTCACGAATCTTTTTCTTATGGACTGGGCTACACCAGCCCCTTTTCTTCCCAGCAACGTCCTCATAGGCATTCTATGTATGTGACCCGTGACAAAGTGAGAGCCAAGGGCTTGGATGGAAGCTTGAGCATAGGGCAAGGGATGGCAGCTAGAGCCAACAGCCTGCAACTCTTGTCACCCCAGCCTGGAGAACAGCTCCCTCCAGAGATGACTGTGGCAAGATCTTCGGTCAAAGAGACCTCCAGAGAAGGCACCTCTTCCTTCCATACACGCCAGAAGTCTGAGGGTGGAGTGTATCATGACCCACACTCTGATGATGGCACAGCCCCCAAAGAAAATAGACACCTATACAATGAcCCTGTGCCAAGGAGAGTTGGTAGCTTTTACAGAGTGCCATCTCCACGTCCAGACAATTCTTTCCATGAAAATAATGTGTCAACTAGAGTTTCTTCTCTACCATCAGAGAGCAGTTCTGGAACCAACCACTCAAAAAGACAACCAGCATTCGATCCATGGAAAAGTCCTGAAAATATTAGTCATTCAGAGCAACTCAAGGAAAAAGAGAAGCAAGGATTTTTCAGGTCAATGAAAAAGAAAAAGAAGAAATCTCAAACAGTACCCAATTCCGACAGCCCTGATCTTCTGACGTTGCAGAAATCCATTCATTCTGCTAGCACTCCAAGCAGCAGACCAAAGGAGTGGCGCCCCGAGAAGATCTCAGATCTGCAGACCCAAAGCCAGCCATTAAAATCACTGCGCAAGTTGTTACATCTCTCTTCGGCCTCAAATCACCCGGCTTCCTCAGATCCCCGCTTCCAGCCCTTAACAGCTCAACAAACCAAAAATTCCTTCTCAGAAATTCGGATTCACCCCCTGAGCCAGGCCTCTGGCGGGAGCAGCAACATCCGGCAGGAACCCGCACCGAAGGGCAGGCCAGCCCTCCAGCTGCCAGACGGTGGATGTGATGGCAGAAGACAGAGACACCATTCTGGACCCCAAGATAGACGCTTCATGTTAAGGACGACAGAACAACAAGGAGAATACTTCTGCTGTGGTGACCCAAAGAAGCCTCACACTCCGTGCGTCCCAAACCGAGCCCTTCATCGTCCAATCTCCAGTCCTGCTCCCTATCCAGTACTCCAGGTCCGAGGCACTTCCATGTGCCCGACACTCCAGGTCCGAGGCACTGATGCTTTCAGCTGCCCAACCCAGCAATCCGGGTTCTCTTTCTTCGTGAGACACGTTATGAGGGAAGCCCTGATTCACAGGGCCCAGGTAAACCAAGCTGCGCTCCTGACATACCATGAGAATGCGGCACTGACGGGCAAGCCGAAGAAGAAGCGCAAGGTCTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPEPIPLLNAKQILGQ LDGGSVAVLPVVDSTNQYLLDRIGELKSGDACIAEYQQAGRGSRGRKWFSPFGANLYLSMFWRLKRGPAAIGLGPVIGIVMAEALRKLGADKVRVKWPND LYLQDRKLAGILVELAGITGDAAQIVIGAGINVAMRRVEESVVNQGWITLQEAGINLDRNTLAATLIRELRAALELFEQEGLAPYLPRWEKLDNFINRPV KLIIGDKEIFGISRGIDKQGALLLEQDGVIKPWMGGEISLRSAEKGSMKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIRKFKDSEENEEV KETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCD FGFARNLSEGNNANYTEYVATRWYRSPELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYSNPRFHGLRFPAVN HPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQRLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHRSNSKDIQNLSVGL PRADEGLPANESFLNGNLAGASLSPLHTKTYQASSQPGSTSKDLTNNNIPHLLSPKEAKSKTEFDFNIDPKPSEGPGTKYLKSNSRSQQNRHSFMESSQS KAGTLQPNEKQSRHSYIDTIPQSSRSPSYRTKAKSHGALSDSKSVSNLSEARAQIAEPSTSRYFPSSCLDLNSPTSPTPTRHSDTRTLLSPSGRNNRNEG TLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGYTSPFSSQQRPHRHSMYVTRDKVRAKGLDGSLSIGQGMAARANSLQLLSPQPGEQL PPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQ PAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQTQSQPLKSLRKLLHLSSASNHPA SSDPRFQPLTAQQTKNSFSEIRIHPLSQASGGSSNIRQEPAPKGRPALQLPDGGCDGRRQRHHSGPQDRRFMLRTTEQQGEYFCCGDPKKPHTPCVPNRA LHRPISSPAPYPVLQVRGTSMCPTLQVRGTDAFSCPTQQSGFSFFVRHVMREALIHRAQVNQAALLTYHENAALTGKPKKKRKV*
Price: £125.00
Completion Time: 
32
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

TurboID

DU Number: 
DU67161
Plasmid: 
pBabeD puro 3FLAG TurboID NLS
Expressed: 
3FLAG TurboID NLS
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
agatctATGAAAGACAATACTGTGCCTCTGAAGCTGATCGCTCTCCTGGCTAATGGCGAGTTCCATAGTGGCGAACAGCTGGGAGAAACCCTGGGCATGTCCAGGGCCGCTATCAACAAGCACATTCAGACTCTGCGCGACTGGGGCGTGGACGTGTTCACCGTGCCCGGAAAGGGCTACTCTCTGCCCGAGCCTATCCCGCTGCTGAACGCTAAACAGATTCTGGGACAGCTGGACGGCGGGAGCGTGGCAGTCCTGCCTGTGGTCGACTCCACCAATCAGTACCTGCTGGATCGAATCGGCGAGCTGAAGAGTGGGGATGCTTGCATTGCAGAATATCAGCAGGCAGGGAGAGGAAGCAGAGGGAGGAAATGGTTCTCTCCTTTTGGAGCTAACCTGTACCTGAGTATGTTTTGGCGCCTGAAGCGGGGACCAGCAGCAATCGGCCTGGGCCCGGTCATCGGAATTGTCATGGCAGAAGCGCTGCGAAAGCTGGGAGCAGACAAGGTGCGAGTCAAATGGCCCAATGACCTGTATCTGCAGGATAGAAAGCTGGCAGGCATCCTGGTGGAGCTGGCCGGAATAACAGGCGATGCTGCACAGATCGTCATTGGCGCCGGGATTAACGTGGCTATGAGGCGCGTGGAGGAAAGCGTGGTCAATCAGGGCTGGATCACACTGCAGGAAGCAGGGATTAACCTGGACAGGAATACTCTGGCCGCTACGCTGATCCGAGAGCTGCGGGCAGCCCTGGAACTGTTCGAGCAGGAAGGCCTGGCTCCATATCTGCCACGGTGGGAGAAGCTGGATAACTTCATCAATAGACCCGTGAAGCTGATCATTGGGGACAAAGAGATTTTCGGGATTAGCCGGGGGATTGATAAACAGGGAGCCCTGCTGCTGGAACAGGACGGAGTTATCAAACCCTGGATGGGCGGAGAAATCAGTCTGCGGTCTGCCGAAAAGCCGAAGAAGAAGCGCAAGGTCtaaggatcc
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPEPIPLLNAKQILGQ LDGGSVAVLPVVDSTNQYLLDRIGELKSGDACIAEYQQAGRGSRGRKWFSPFGANLYLSMFWRLKRGPAAIGLGPVIGIVMAEALRKLGADKVRVKWPND LYLQDRKLAGILVELAGITGDAAQIVIGAGINVAMRRVEESVVNQGWITLQEAGINLDRNTLAATLIRELRAALELFEQEGLAPYLPRWEKLDNFINRPV KLIIGDKEIFGISRGIDKQGALLLEQDGVIKPWMGGEISLRSAEKPKKKRKV*
Price: £125.00
Completion Time: 
15
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

FBXO16

cDNA Synonyms: 
FBX16
DU Number: 
DU67173
Plasmid: 
pBabeD puro 3FLAG GSGSGS FBXO16
Expressed: 
3FLAG GSGSGS FBXO16
Genbank: 
NM_172366.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGATGGCATTTGCACCTCCAAAAAACACAGATGGTCCCAAAATGCAGACAAAGATGAGCACCTGGACACCCCTAAACCATCAGCTATTGAATGACCGGGTATTTGAAGAAAGAAGAGCCCTGCTTGGCAAATGGTTTGACAAATGGACAGACTCTCAAAGAAGAAGAATCCTCACAGGCCTGTTGGAGCGCTGCTCGCTGTCCCAGCAAAAGTTCTGCTGTCGAAAGCTTCAAGAGAAAATTCCAGCAGAAGCCCTGGACTTTACAACCAAGCTTCCAAGGGTGTTATCTTTATACATCTTTTCTTTCCTGGACCCTCGGAGCCTTTGTCGTTGTGCACAGGTGTGCTGGCATTGGAAGAACCTTGCTGAGCTGGACCAGCTCTGGATGCTGAAATGTTTACGGTTTAACTGGTACATCAATTTCTCTCCAACTCCCTTTGAGCAGGGGATCTGGAAGAAGCACTATATTCAAATGGTGAAAGAACTTCATATTACCAAGCCTAAGACACCCCCAAAGGATGGATTTGTAATCGCTGACGTTCAACTAGTTACAAGCAATTCTCCAGAGGAAAAACAGTCCCCTTTATCAGCTTTTCGGTCCTCTTCCTCTTTAAGAAAGAAGAATAACTCAGGGGAGAAAGCACTTCCACCCTGGCGATCTTCTGATAAGCACCCAACAGATATCATTCGTTTTAATTACCTAGACAACCGTGACCCCATGGAGACTGTCCAGCAAGGAAGAAGAAAAAGAAACCAAATGACCCCAGACTTCAGCCGACAGTCACATGATAAGAAAAATAAATTGCAGGACAGAACTAGGCTAAGAAAAGCACAATCAATGATGTCGAGGAGAAATCCCTTCCCACTATGTCCCTAAgcggccgc
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSGSGSMMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQK FCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTP PKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQD RTRLRKAQSMMSRRNPFPLCP*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

FBXL7

cDNA Synonyms: 
FBL6; FBL7
DU Number: 
DU67172
Plasmid: 
pBabeD puro 3FLAG GSGSGS FBXL7
Expressed: 
3FLAG GSGSGS FBXL7
Genbank: 
NM_012304.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGGCGCGAACAATGGCAAACAGTACGGCAGTGAGGGCAAAGGCAGCTCGAGCATCTCATCTGACGTGAGTTCAAGTACAGATCACACGCCCACTAAAGCCCAGAAGAATGTGGCTACCAGCGAAGACTCCGACCTGAGCATGCGCACACTGAGCACGCCCAGCCCAGCCCTGATATGTCCACCGAATCTCCCAGGATTTCAGAATGGAAGGGGCTCGTCCACCTCCTCGTCCTCCATCACCGGGGAGACGGTGGCCATGGTGCACTCCCCGCCCCCGACCCGCCTCACACACCCGCTCATCCGGCTCGCCTCCAGACCCCAGAAGGAGCAGGCCAGCATAGACCGGCTCCCGGACCACTCCATGGTGCAGATCTTCTCCTTCCTGCCCACCAACCAGCTGTGCCGCTGCGCGCGAGTGTGCCGCCGCTGGTACAACCTGGCCTGGGACCCGCGGCTCTGGAGGACTATCCGCCTGACGGGCGAGACCATCAACGTGGACCGCGCCCTCAAGGTGCTGACCCGCAGACTCTGCCAGGACACCCCCAACGTGTGTCTCATGCTGGAAACCGTAACTGTCAGTGGCTGCAGGCGGCTCACAGACCGAGGGCTGTACACCATCGCCCAGTGCTGCCCCGAACTGAGGCGACTGGAAGTCTCAGGCTGTTACAATATCTCCAACGAGGCCGTCTTTGATGTGGTGTCCCTCTGCCCTAATCTGGAGCACCTGGATGTGTCAGGATGCTCCAAAGTGACCTGCATCAGCTTGACCCGGGAGGCCTCCATTAAACTGTCACCCTTGCATGGCAAACAGATTTCCATCCGCTACCTGGACATGACGGACTGCTTCGTGCTGGAGGACGAAGGCCTGCACACCATCGCGGCGCACTGCACGCAGCTCACCCACCTCTACCTGCGCCGCTGCGTCCGCCTGACCGACGAAGGCCTGCGCTACCTGGTGATCTACTGCGCCTCCATCAAGGAGCTGAGCGTCAGCGACTGCCGCTTCGTCAGCGACTTCGGCCTGCGGGAGATCGCCAAGCTGGAGTCCCGCCTGCGGTACCTGAGCATCGCGCACTGCGGCCGGGTCACCGACGTGGGCATCCGCTACGTGGCCAAGTACTGCAGCAAGCTGCGCTACCTCAACGCGAGGGGCTGCGAGGGCATCACGGACCACGGTGTGGAGTACCTCGCCAAGAACTGCACCAAACTCAAATCCCTGGATATCGGCAAATGCCCTTTGGTATCCGACACGGGCCTGGAGTGCCTGGCCCTGAACTGCTTCAACCTCAAGCGGCTCAGCCTCAAGTCCTGCGAGAGCATCACCGGCCAGGGCTTGCAGATCGTGGCCGCCAACTGCTTTGACCTCCAGACGCTGAATGTCCAGGACTGCGAGGTCTCCGTGGAGGCCCTGCGCTTTGTCAAACGCCACTGCAAGCGCTGCGTCATCGAGCACACCAACCCGGCTTTCTTCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSGSGSMGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALICPPNLPGFQNGR GSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALK VLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQ ISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYV AKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEAL RFVKRHCKRCVIEHTNPAFF*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.