3FLAG

FBXL4

DU Number: 
DU47085
Plasmid: 
pcDNA5 FRT/TO FBXL4 1-370 FS*15 3FLAG
Expressed: 
FBXL4 1-370 FS*15 3FLAG
Genbank: 
Q9UKA2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
CTCGAGATGTCACCGGTCTTTCCCATGTTAACAGTTCTGACCATGTTTTA TTATATATGCCTTCGGCGCCGAGCCAGGACAGCTACAAGAGGAGAAATGA TGAACACCCATAGAGCTATAGAATCAAACAGCCAGACTTCCCCTCTCAAT GCAGAGGTAGTCCAGTATGCCAAAGAAGTAGTGGATTTCAGTTCCCATTA TGGAAGTGAGAATAGTATGTCCTATACTATGTGGAATTTGGCTGGTGTAC CAAATGTATTCCCAAGTTCTGGTGACTTTACTCAGACAGCTGTGTTTCGA ACTTATGGGACATGGTGGGATCAGTGTCCTAGTGCTTCCTTGCCATTCAA GAGGACGCCACCTAATTTTCAGAGCCAGGACTATGTGGAACTTACTTTTG AACAACAGGTGTATCCTACAGCTGTACATGTTCTAGAAACCTATCATCCC GGAGCAGTCATTAGAATTCTCGCTTGTTCTGCAAATCCTTATTCCCCAAA TCCACCAGCTGAAGTAAGATGGGAGATTCTTTGGTCAGAGAGACCTACGA AGGTGAATGCTTCCCAAGCTCGCCAGTTTAAACCTTGTATTAAGCAGATA AATTTCCCCACAAATCTTATACGACTGGAAGTAAATAGTTCTCTTCTGGA ATATTACACTGAATTAGATGCAGTTGTGCTACATGGTGTGAAGGACAAGC CAGTGCTTTCTCTCAAGACTTCACTTATTGACATGAATGATATAGAAGAT GATGCCTATGCAGAAAAGGATGGTTGTGGAATGGACAGTCTTAACAAAAA GTTTAGCAGTGCTGTCCTCGGGGAAGGGCCAAATAATGGGTATTTTGATA AACTACCTTATGAGCTTATTCAGCTGATTCTGAATCATCTTACACTACCA GACCTGTGTAGATTAGCACAGACTTGCAAACTACTGAGCCAGCATTGCTG TGATCCTCTGCAATACATCCACCTCAATCTGCAACCATACTGGGCAAAAC TAGATGACACTTCTCTGGAATTTCTACAGTCTCGCTGCACTCTTGTCCAG TGGCTTAATTTATCTTGGACTGCAATAGAGGCTTCATCTCTGTTGCAGGA TTTAGCAGGTTTCGCGGCCGC
Amino Acid Sequence: 
MSPVFPMLTVLTMFYYICLRRRARTATRGEMMNTHRAIESNSQTSPLNAE VVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTY GTWWDQCPSASLPFKRTPPNFQSQDYVELTFEQQVYPTAVHVLETYHPGA VIRILACSANPYSPNPPAEVRWEILWSERPTKVNASQARQFKPCIKQINF PTNLIRLEVNSSLLEYYTELDAVVLHGVKDKPVLSLKTSLIDMNDIEDDA YAEKDGCGMDSLNKKFSSAVLGEGPNNGYFDKLPYELIQLILNHLTLPDL CRLAQTCKLLSQHCCDPLQYIHLNLQPYWAKLDDTSLEFLQSRCTLVQWL NLSWTAIEASSLLQDLAGFAAADYKDDDDKDYKDDDDKDYKDDDDK*
Price: £125.00
Completion Time: 
142

FBXL4

DU Number: 
DU47019
Plasmid: 
pcDNA frt to -c-3xFLAG FBXL4 I205T
Expressed: 
FBXL4-FLAGx3 [I205T mutant]
Genbank: 
Q9UKA2
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
ATGTCACCGGTCTTTCCCATGTTAACAGTTCTGACCATGTTTTATTATATATGCCTTCGGCGCCGAGCCAGGACAGCTACAAGAGGAGAAATGATGAACACCCATAGAGCTATAGAATCAAACAGCCAGACTTCCCCTCTCAATGCAGAGGTAGTCCAGTATGCCAAAGAAGTAGTGGATTTCAGTTCCCATTATGGAAGTGAGAATAGTATGTCCTATACTATGTGGAATTTGGCTGGTGTACCAAATGTATTCCCAAGTTCTGGTGACTTTACTCAGACAGCTGTGTTTCGAACTTATGGGACATGGTGGGATCAGTGTCCTAGTGCTTCCTTGCCATTCAAGAGGACGCCACCTAATTTTCAGAGCCAGGACTATGTGGAACTTACTTTTGAACAACAGGTGTATCCTACAGCTGTACATGTTCTAGAAACCTATCATCCCGGAGCAGTCATTAGAATTCTCGCTTGTTCTGCAAATCCTTATTCCCCAAATCCACCAGCTGAAGTAAGATGGGAGATTCTTTGGTCAGAGAGACCTACGAAGGTGAATGCTTCCCAAGCTCGCCAGTTTAAACCTTGTATTAAGCAGATAAATTTCCCCACAAATCTTACACGACTGGAAGTAAATAGTTCTCTTCTGGAATATTACACTGAATTAGATGCAGTTGTGCTACATGGTGTGAAGGACAAGCCAGTGCTTTCTCTCAAGACTTCACTTATTGACATGAATGATATAGAAGATGATGCCTATGCAGAAAAGGATGGTTGTGGAATGGACAGTCTTAACAAAAAGTTTAGCAGTGCTGTCCTCGGGGAAGGGCCAAATAATGGGTATTTTGATAAACTACCTTATGAGCTTATTCAGCTGATTCTGAATCATCTTACACTACCAGACCTGTGTAGATTAGCACAGACTTGCAAACTACTGAGCCAGCATTGCTGTGATCCTCTGCAATACATCCACCTCAATCTGCAACCATACTGGGCAAAACTAGATGACACTTCTCTGGAATTTCTACAGTCTCGCTGCACTCTTGTCCAGTGGCTTAATTTATCTTGGACTGGCAATAGAGGCTTCATCTCTGTTGCAGGATTTAGCAGGTTTCTGAAGGTTTGTGGATCCGAATTAGTACGCCTTGAATTGTCTTGCAGCCACTTTCTTAATGAAACTTGCTTAGAAGTTATTTCTGAGATGTGTCCAAATCTACAGGCCTTAAATCTCTCCTCCTGTGATAAGCTACCACCTCAAGCTTTCAACCACATTGCCAAGTTATGCAGCCTTAAACGACTTGTTCTCTATCGAACAAAAGTAGAGCAAACAGCACTGCTCAGCATTTTGAACTTCTGTTCAGAGCTTCAGCACCTCAGTTTAGGCAGTTGTGTCATGATTGAAGACTATGATGTGATAGCTAGCATGATAGGAGCCAAGTGTAAAAAACTCCGGACCCTGGATCTGTGGAGATGTAAGAATATTACTGAGAATGGAATAGCAGAACTGGCTTCTGGGTGTCCACTACTGGAGGAGCTTGACCTTGGCTGGTGCCCAACTCTGCAGAGCAGCACCGGGTGCTTCACCAGACTGGCACACCAGCTCCCAAACTTGCAAAAACTCTTTCTTACAGCTAATAGATCTGTGTGTGACACAGACATTGATGAATTGGCATGTAATTGTACCAGGTTACAGCAGCTGGACATATTAGGAACAAGAATGGTAAGTCCGGCATCCTTAAGAAAACTCCTGGAATCTTGTAAAGATCTTTCTTTACTTGATGTGTCCTTCTGTTCGCAGATTGATAACAGAGCTGTGCTAGAACTGAATGCAAGCTTTCCAAAAGTGTTCATAAAAAAGAGCTTTACTCAG
Amino Acid Sequence: 
MSPVFPMLTVLTMFYYICLRRRARTATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSASLPFKRTPPNFQSQDYVELTFEQQVYPTAVHVLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERPTKVNASQARQFKPCIKQINFPTNLTRLEVNSSLLEYYTELDAVVLHGVKDKPVLSLKTSLIDMNDIEDDAYAEKDGCGMDSLNKKFSSAVLGEGPNNGYFDKLPYELIQLILNHLTLPDLCRLAQTCKLLSQHCCDPLQYIHLNLQPYWAKLDDTSLEFLQSRCTLVQWLNLSWTGNRGFISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQALNLSSCDKLPPQAFNHIAKLCSLKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKKLRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKLFLTANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDNRAVLELNASFPKVFIKKSFTQSGRDYKDDDDKDYKDDDDKDYKDDDDK*
Price: £125.00
Completion Time: 
57

CaCUL1

cDNA Synonyms: 
CAC1; C10orf46; CDK2-associated, cullin domain 1
DU Number: 
DU25012
Plasmid: 
pCMV5 3x Flag CaCul1
Expressed: 
3xFlag-CaCUL1
Genbank: 
NM_153810.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGACTACAAGGACGACGATGACAAGGACTACAAGGACGACGATGACAAGGACTACAAGGACGACGATGACAAGATGGAGGAAAGCATGGAAGAGGAGGAGGGGGGCAGCTACGAGGCGATGATGGACGACCAGAACCACAACAACTGGGAGGCTGCGGTGGACGGCTTCCGGCAGCCCCTGCCACCTCCGCCGCCCCCCTCGTCGATCCCGGCCCCTGCCCGAGAGCCTCCGGGGGGGCAGCTGCTGGCGGTGCCCGCGGTCTCCGTGGACAGGAAAGGCCCCAAGGAGGGGCTCCCGATGGGGCCGCAGCCACCGCCGGAGGCTAATGGGGTGATCATGATGTTGAAGAGCTGCGACGCGGCCGCCGCCGTGGCCAAGGCGGCCCCCGCCCCCACCGCCAGCTCCACCATCAACATCAACACCTCCACCTCCAAGTTCTTAATGAATGTTATAACTATTGAAGATTATAAGAGCACATACTGGCCAAAATTGGATGGTGCCATAGATCAACTTTTAACTCAGAGTCCTGGTGACTATATCCCCATATCCTATGAACAGATATACAGTTGTGTGTATAAATGTGTATGCCAGCAGCACTCGGAACAGATGTATAGTGATCTGATTAAAAAGATAACTAATCACTTAGAGAGAGTCTCAAAGGAGCTGCAGGCCAGCCCTCCAGATCTCTATATTGAAAGATTTAATATAGCTCTTGGACAATATATGGGAGCATTGCAGAGCATTGTGCCTCTTTTCATATATATGAATAAGTTTTACATCGAAACCAAGCTTAACAGAGACTTAAAAGATGACCTTATAAAGCTGTTTACGGAACATGTTGCAGAAAAGCACATTTACAGCCTAATGCCTTTACTTTTAGAAGCCCAGTCAACACCATTTCAGGTCACACCTTCAACTATGGCAAATATTGTGAAAGGCCTGTATACCCTCAGACCAGAGTGGGTTCAGATGGCTCCAACTCTATTTTCTAAATTTATTCCAAACATTCTCCCTCCGGCGGTGGAATCTGAACTTTCTGAATATGCTGCTCAAGATCAGAAATTTCAAAGAGAACTTATACAGAATGGTTTTACAAGGGGTGACCAGTCCCGGAAGAGAGCTGGGGATGAGTTGGCTTATAATAGCTCGTCAGCATGTGCAAGTTCCAGGGGGTACAGATAGGAATTC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKMEESMEEEEGGSYEAMMDDQNHNNWEAAVDGFRQPLPPPPPPSSIPAPAREPPGGQLLAVPAVSVDRKGPKEGLPMGPQPPPEANGVIMMLKSCDAAAAVAKAAPAPTASSTININTSTSKFLMNVITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMYSDLIKKITNHLERVSKELQASPPDLYIERFNIALGQYMGALQSIVPLFIYMNKFYIETKLNRDLKDDLIKLFTEHVAEKHIYSLMPLLLEAQSTPFQVTPSTMANIVKGLYTLRPEWVQMAPTLFSKFIPNILPPAVESELSEYAAQDQKFQRELIQNGFTRGDQSRKRAGDELAYNSSSACASSRGYR*
Price: £125.00
Completion Time: 
37

Emerin

cDNA Synonyms: 
EDMD
LEMD5
STA
DU Number: 
DU45265
Plasmid: 
pcDNA5-FRT/TO-3XFLAG Emerin P183-F254
Expressed: 
3XFLAG Emerin P183-F254
Genbank: 
NM_000117.2 GI:195234784
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCGACTACAAGGACGACGATGACAAGGATTATAAGGATGACGACGACAAACCTACTTCCTCCTCCACCTCTTTTATGTCCTCCTCATCATCTTCCTCTTCATGGCTCACCCGCCGTGCCATCCGGCCTGAAAACCGTGCTCCTGGGGCTGGGCTGGGCCAGGATCGCCAGGTCCCGCTCTGGGGCCAGCTGCTGCTTTTCCTGGTCTTTGTGATCGTCCTCTTCTTCATTTACCACTTCATGCAGGCTGAAGAAGGCAACCCCTTCTAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKPTSSSTSFMSSSSSSSSWLTRRA IRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLFFIYHFMQAEEGNPF*
Price: £125.00
Completion Time: 
19

Human PINK1 (residues 1-103)

DU Number: 
DU46105
Plasmid: 
pcDNA5FRTTO Pink1 1-103 3FLAG
Expressed: 
PINK1 1-103 3FLAG
Genbank: 
Q9BXM7
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCGGTGCGACAGGCGCTGGGCCGCGGCCTGCAGCTGGGTCG AGCGCTGCTGCTGCGCTTCACGGGCAAGCCCGGCCGGGCCTACGGCTTGG GGCGGCCGGGCCCGGCGGCGGGCTGTGTCCGCGGGGAGCGTCCAGGCTGG GCCGCAGGACCGGGCGCGGAGCCTCGCAGGGTCGGGCTCGGGCTCCCTAA CCGTCTCCGCTTCTTCCGCCAGTCGGTGGCCGGGCTGGCGGCGCGGTTGC AGCGGCAGTTCGTGGTGCGGGCCTGGGGCTGCGCGGGCCCTTGCGGCCGG GCAGTCTTTCTGGCCGACTACAAGGACGACGACAAGATGGACTACAAGGA CGACGACAAGATGGACTACAAGGACGACGATGACAAGTAAGCGGCCGC
Amino Acid Sequence: 
MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAA GPGAEPRRVGLGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAV FLADYKDDDKMDYKDDDKMDYKDDDDK*
Price: £125.00
Completion Time: 
281

ALK3

DU Number: 
DU42276
Plasmid: 
pCMV5-FLAG-2xFlag-ALK3
Expressed: 
3xFLAG-ALK3
Genbank: 
NM_004329.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
acggatccgactacaaggacgatgacgataaggactacaaggacgatgacgataagatgcctcagctatacatttacatcagattattgggagcctatttgttcatcatttctcgtgttcaaggacagaatctggatagtatgcttcatggcactgggatgaaatcagactccgaccagaaaaagtcagaaaatggagtaaccttagcaccagaggataccttgccttttttaaagtgctattgctcagggcactgtccagatgatgctattaataacacatgcataactaatggacattgctttgccatcatagaagaagatgaccagggagaaaccacattagcttcagggtgtatgaaatatgaaggatctgattttcagtgcaaagattctccaaaagcccagctacgccggacaatagaatgttgtcggaccaatttatgtaaccagtatttgcaacccacactgccccctgttgtcataggtccgttttttgatggcagcattcgatggctggttttgctcatttctatggctgtctgcataattgctatgatcatcttctccagctgcttttgttacaaacattattgcaagagcatctcaagcagacgtcgttacaatcgtgatttggaacaggatgaagcatttattccagttggagaatcactaaaagaccttattgaccagtcacaaagttctggtagtgggtctggactacctttattggttcagcgaactattgccaaacagattcagatggtccggcaagttggtaaaggccgatatggagaagtatggatgggcaaatggcgtggcgaaaaagtggcggtgaaagtattctttaccactgaagaagccagctggtttcgagaaacagaaatctaccaaactgtgctaatgcgccatgaaaacatacttggtttcatagcggcagacattaaaggtacaggttcctggactcagctctatttgattactgattaccatgaaaatggatctctctatgacttcctgaaatgtgctacactggacaccagagccctgcttaaattggcttattcagctgcctgtggtctgtgccacctgcacacagaaatttatggcacccaaggaaagcccgcaattgctcatcgagacctaaagagcaaaaacatcctcatcaagaaaaatgggagttgctgcattgctgacctgggccttgctgttaaattcaacagtgacacaaatgaagttgatgtgcccttgaataccagggtgggcaccaaacgctacatggctcccgaagtgctggacgaaagcctgaacaaaaaccacttccagccctacatcatggctgacatctacagcttcggcctaatcatttgggagatggctcgtcgttgtatcacaggagggatcgtggaagaataccaattgccatattacaacatggtaccgagtgatccgtcatacgaagatatgcgtgaggttgtgtgtgtcaaacgtttgcggccaattgtgtctaatcggtggaacagtgatgaatgtctacgagcagttttgaagctaatgtcagaatgctgggcccacaatccagcctccagactcacagcattgagaattaagaagacgcttgccaagatggttgaatcccaagatgtaaaaatctgagcggccgc
Price: £125.00
Completion Time: 
37

PINK1

DU Number: 
DU34338
Plasmid: 
pBabe hygro PINK1 3FLAG
Expressed: 
PINK1 3FLAG
Genbank: 
NM_032409
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCGCCACCATGGCGGTGCGACAGGCGCTGGGCCGCGGCCTGCAGCTGGGTCGAGCGCTGCTGCTGCGCTTCACGGGCAAGCCCGGCCGGGCCTACGGCTTGGGGCGGCCGGGCCCGGCGGCGGGCTGTGTCCGCGGGGAGCGTCCAGGCTGGGCCGCAGGACCGGGCGCGGAGCCTCGCAGGGTCGGGCTCGGGCTCCCTAACCGTCTCCGCTTCTTCCGCCAGTCGGTGGCCGGGCTGGCGGCGCGGTTGCAGCGGCAGTTCGTGGTGCGGGCCTGGGGCTGCGCGGGCCCTTGCGGCCGGGCAGTCTTTCTGGCCTTCGGGCTAGGGCTGGGCCTCATCGAGGAAAAACAGGCGGAGAGCCGGCGGGCGGTCTCGGCCTGTCAGGAGATCCAGGCAATTTTTACCCAGAAAAGCAAGCCGGGGCCTGACCCGTTGGACACGAGACGCTTGCAGGGCTTTCGGCTGGAGGAGTATCTGATAGGGCAGTCCATTGGTAAGGGCTGCAGTGCTGCTGTGTATGAAGCCACCATGCCTACATTGCCCCAGAACCTGGAGGTGACAAAGAGCACCGGGTTGCTTCCAGGGAGAGGCCCAGGTACCAGTGCACCAGGAGAAGGGCAGGAGCGAGCTCCGGGGGCCCCTGCCTTCCCCTTGGCCATCAAGATGATGTGGAACATCTCGGCAGGTTCCTCCAGCGAAGCCATCTTGAACACAATGAGCCAGGAGCTGGTCCCAGCGAGCCGAGTGGCCTTGGCTGGGGAGTATGGAGCAGTCACTTACAGAAAATCCAAGAGAGGTCCCAAGCAACTAGCCCCTCACCCCAACATCATCCGGGTTCTCCGCGCCTTCACCTCTTCCGTGCCGCTGCTGCCAGGGGCCCTGGTCGACTACCCTGATGTGCTGCCCTCACGCCTCCACCCTGAAGGCCTGGGCCATGGCCGGACGCTGTTCCTCGTTATGAAGAACTATCCCTGTACCCTGCGCCAGTACCTTTGTGTGAACACACCCAGCCCCCGCCTCGCCGCCATGATGCTGCTGCAGCTGCTGGAAGGCGTGGACCATCTGGTTCAACAGGGCATCGCGCACAGAGACCTGAAATCCGACAACATCCTTGTGGAGCTGGACCCAGACGGCTGCCCCTGGCTGGTGATCGCAGATTTTGGCTGCTGCCTGGCTGATGAGAGCATCGGCCTGCAGTTGCCCTTCAGCAGCTGGTACGTGGATCGGGGCGGAAACGGCTGTCTGATGGCCCCAGAGGTGTCCACGGCCCGTCCTGGCCCCAGGGCAGTGATTGACTACAGCAAGGCTGATGCCTGGGCAGTGGGAGCCATCGCCTATGAAATCTTCGGGCTTGTCAATCCCTTCTACGGCCAGGGCAAGGCCCACCTTGAAAGCCGCAGCTACCAAGAGGCTCAGCTACCTGCACTGCCCGAGTCAGTGCCTCCAGACGTGAGACAGTTGGTGAGGGCACTGCTCCAGCGAGAGGCCAGCAAGAGACCATCTGCCCGAGTAGCCGCAAATGTGCTTCATCTAAGCCTCTGGGGTGAACATATTCTAGCCCTGAAGAATCTGAAGTTAGACAAGATGGTTGGCTGGCTCCTCCAACAATCGGCCGCCACTTTGTTGGCCAACAGGCTCACAGAGAAGTGTTGTGTGGAAACAAAAATGAAGATGCTCTTTCTGGCTAACCTGGAGTGTGAAACGCTCTGCCAGGCAGCCCTCCTCCTCTGCTCATGGAGGGCAGCCCTGGACTACATGGACGACGATGACAAGGACTACAAGGACGACGATGACAAGGACTACAAGGACGACGATGACAAGTAGAATTC
Amino Acid Sequence: 
MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAV FLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSA PGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLP SRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPF SSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALLQREASKRPSA RVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAALDYMDDDDKDYKDDDDKDYK DDDDK*
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Restricted Distribution: 
Not Restricted
COVID-19: 
No

IL1 beta (mouse)

cDNA Synonyms: 
IL1b
DU Number: 
DU32867
Plasmid: 
pcDNA3-3FLAG-P-MoTAP IL1beta 124-269 (mouse)
Expressed: 
3FLAG P moTAP IL1beta (mouse) 124-269
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Price: £125.00
Completion Time: 
0

IL1 beta

cDNA Synonyms: 
IL1b
DU Number: 
DU32865
Plasmid: 
pcDNA3-3FLAG-P-MoTAP IL1beta 117-266 human
Expressed: 
3FLAG P moTAP IL1beta 117-266
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
CCATGGACTACAAGGACGACGATGACAAGGACTACAAGGACGACGATGACAAGGACTACAAGGACGACGATGACAAGCTCGACTTAGAAGTTTTATTTCA AGGTATGGCTGGTGGTTTAAATGATATTTTTGAAGCTCAAAAAGAATGGCATGAATTCGGATCCGCACCTGTACGATCACTGAACTGCACGCTCCGGGAC TCACAGCAAAAAAGCTTGGTGATGTCTGGTCCATATGAACTGAAAGCTCTCCACCTCCAGGGACAGGATATGGAGCAACAAGTGGTGTTCTCCATGTCCT TTGTACAAGGAGAAGAAAGTAATGACAAAATACCTGTGGCCTTGGGCCTCAAGGAAAAGAATCTGTACCTGTCCTGCGTGTTGAAAGATGATAAGCCCAC TCTACAGCTGGAGAGTGTAGATCCCAAAAATTACCCAAAGAAGAAGATGGAAAAGCGATTTGTCTTCAACAAGATAGAAATCAATAACAAGCTGGAATTT GAGTCTGCCCAGTTCCCCAACTGGTACATCAGCACCTCTCAAGCAGAAAACATGCCCGTCTTCCTGGGAGGGACCAAAGGCGGCCAGGATATAACTGACT TCACCATGCAATTTGTGTCTTCCTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKLDLEVLFQGMAGGLNDIFEAQKEWHEFGSAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSF VQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDF TMQFVSS*
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.