3FLAG

NEK11

DU Number: 
DU66194
Plasmid: 
pcDNA FRT TO 3 FLAG NEK11 tv4 (Long)
Expressed: 
3FLAG NEK11 tv4 (Long)
Genbank: 
NM_001321220.1
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGCTGAAATTCCAAGAGGCAGCTAAGTGTGTGAGTGGATCAACAGCCATTTCCACTTATCCAAAGACCTTGATTGCAAGAAGATACGTGCTTCAACAAAAACTTGGCAGTGGAAGTTTTGGAACTGTCTATCTGGTTTCAGACAAGAAAGCCAAACGAGGAGAGGAATTAAAGGTACTTAAGGAAATATCTGTTGGAGAACTAAATCCAAATGAAACTGTACAGGCCAATTTGGAAGCCCAACTCCTCTCCAAGCTGGACCACCCAGCCATTGTCAAGTTCCATGCAAGTTTTGTGGAGCAAGATAATTTCTGCATTATCACGGAGTACTGTGAGGGCCGAGATCTGGACGATAAAATTCAGGAATATAAACAAGCTGGAAAAATCTTTCCAGAAAATCAAATAATAGAATGGTTTATCCAGCTGCTGCTGGGAGTTGACTACATGCATGAGAGGAGGATACTTCATCGAGACTTAAAGTCAAAGAATGTATTTCTGAAAAATAATCTCCTTAAAATTGGAGATTTTGGAGTTTCTCGACTTCTAATGGGATCCTGTGACCTGGCCACAACTTTAACTGGAACTCCCCATTATATGAGTCCTGAGGCTCTGAAACACCAAGGCTATGACACAAAGTCGGACATCTGGTCACTGGCATGCATTTTGTATGAGATGTGCTGCATGAATCATGCATTCGCTGGCTCCAATTTCTTATCCATTGTTTTAAAAATTGTTGAAGGTGACACACCTTCTCTCCCTGAGAGATATCCAAAAGAACTAAATGCCATCATGGAAAGCATGTTGAACAAGAATCCTTCATTAAGACCATCTGCTATCGAAATTTTAAAAATCCCTTACCTTGATGAGCAGCTACAGAACCTAATGTGTAGATATTCAGAAATGACTCTGGAAGACAAAAATTTGGATTGTCAGAAGGAGGCTGCTCATATAATTAATGCCATGCAAAAAAGGATCCACCTGCAGACTCTGAGGGCACTGTCAGAAGTACAGAAAATGACGCCAAGAGAAAGGATGCGGCTGAGGAAGCTCCAGGCGGCTGATGAGAAAGCCAGGAAGCTGAAAAAGATTGTGGAAGAAAAATATGAAGAAAATAGCAAACGAATGCAAGAATTGAGATCTCGGAACTTTCAGCAGCTGAGTGTTGATGTACTCCATGAAAAAACACATTTAAAAGGAATGGAAGAAAAGGAGGAGCAACCTGAGGGAAGACTTTCTTGTTCACCCCAGGACGAGGATGAAGAGAGGTGGCAAGGCAGGGAAGAGGAATCTGATGAACCAACTTTAGAGAACCTGCCTGAGTCTCAGCCTATTCCTTCCATGGACCTCCACGAACTTGAATCAATTGTAGAGGATGCCACATCTGACCTTGGATACCATGAGATCCCAGAAGACCCACTTGTGGCTGAAGAGTACTACGCTGATGCATTTGATTCCTATTGTGAAGAGAGTGATGAGGAGGAAGAAGAAATAGCGTTAGAAAGACCAGAGAAAGAAATCAGGAATGAGGGATCCCAGCCTGCTTACAGAACAAACCAACAGGACAGTGATATCGAAGCGTTGGCCAGGTGTTTGGAAAATGTCCTGGGTTGCACTTCTCTAGACACAAAGACCATCACCACCATGGCTGAAGACATGTCCCCAGGACCACCAATTTTCAACAGTGTGATGGCCAGGACCAAGATGAAACGCATGAGGGAATCAGCCATGCAGAAGCTGGGGACAGAAGTATTTGAAGAGGTCTATAATTACCTCAAGAGAGCAAGGCATCAGAATGCTAGCGAAGCAGAGATCCGCGAGTGTTTGGAAAAAGTGGTGCCTCAAGCCAGCGACTGTTTTGAAGTGGACCAGCTCCTGTACTTTGAAGAGCAGTTGCTGATCACGATGGGAAAAGAACCTACTCTCCAGAACCATCTCTAGGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSPEFMLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDEERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYADAFDSYCEESDEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMSPGPPIFNSVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNASEAEIRECLEKVVPQASDCFEVDQLLYFEEQLLITMGKEPTLQNHL*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

ZAP3

cDNA Synonyms: 
C14orf170; PPP1R169; ZAP113; YLPM1
DU Number: 
DU67260
Plasmid: 
pBabeD puro 3FLAG ZAP3
Expressed: 
3FLAG ZAP3
Genbank: 
NM_019589.2 with one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGTACCCGAATTGGGGCCGGTATGGCGGGAGCAGCCACTATCCGCCGCCACCGGTCCCACCGCCGCCGCCAGTGGCGCTTCCTGAGGCCTCGCCGGGGCCCGGGTACTCGAGCTCGACGACTCCCGCGGCCCCCTCCTCCTCGGGCTTCATGAGCTTCCGCGAACAGCACTTGGCGCAGCTCCAGCAGCTGCAGCAGATGCACCAGAAGCAAATGCAGTGCGTGCTTCAGCCCCACCACCTTCCTCCGCCCCCTCTGCCGCCCCCGCCAGTGATGCCGGGGGGCGGCTACGGAGACTGGCAGCCGCCACCGCCACCGATGCCCCCGCCACCCGGGCCGGCCCTCAGCTATCAGAAGCAGCAGCAGTACAAACACCAGATGCTCCACCACCAACGAGACGGGCCTCCTGGTTTGGTTCCAATGGAGCTGGAATCCCCCCCTGAATCTCCCCCTGTGCCGCCTGGGTCCTATATGCCCCCATCTCAGTCTTACATGCCCCCACCTCAGCCGCCACCCTCTTACTACCCCCCGACCTCATCTCAGCCCTACCTGCCTCCTGCTCAGCCGTCCCCTTCGCAGTCCCCACCTTCCCAATCCTACCTGGCGCCCACCCCTTCTTACTCATCCTCCTCCTCTTCCTCGCAATCCTATTTGAGCCATTCCCAGTCCTACTTGCCCTCTTCTCAGGCATCTCCTTCCCGCCCCTCCCAGGGCCATTCTAAATCCCAACTACTAGCTCCACCACCACCGTCCGCCCCCCCTGGAAATAAGACAACTGTCCAGCAAGAGCCTTTGGAGAGTGGGGCCAAAAACAAGAGTACTGAACAGCAGCAAGCCGCCCCTGAGCCAGATCCCTCTACGATGACTCCACAGGAACAGCAGCAGTATTGGTATCGACAGCACTTGCTTAGTTTGCAACAGAGGACAAAAGTTCATTTGCCAGGACACAAAAAGGGTCCTGTGGTAGCAAAGGATACACCAGAGCCGGTAAAAGAAGAAGTTACAGTACCTGCCACCAGTCAAGTTCCAGAATCTCCTTCTTCTGAGGAGCCCCCATTGCCACCTCCAAATGAGGAAGTGCCACCTCCTCTCCCACCTGAGGAACCCCAGTCTGAGGACCCAGAAGAAGATGCCAGGTTAAAGCAGTTGCAGGCTGCAGCAGCACACTGGCAGCAGCACCAGCAGCATCGAGTCGGTTTCCAGTATCAGGGAATAATGCAGAAGCACACTCAGTTACAGCAGATTCTACAACAGTATCAGCAGATTATACAGCCCCCACCACATATACAGACCATGTCTGTAGATATGCAGCTGCGGCATTATGAGATGCAGCAGCAACAGTTTCAACATCTTTACCAAGAATGGGAGCGAGAGTTTCAGCTATGGGAGGAACAACTCCATTCCTATCCTCATAAAGATCAGCTTCAGGAGTATGAGAAGCAGTGGAAAACATGGCAGGGACATATGAAAGCCACTCAGAGCTATCTCCAGGAGAAAGTCAATTCATTTCAGAACATGAAGAACCAGTATATGGGGAACATGTCAATGCCACCTCCTTTTGTTCCATATTCTCAGATGCCTCCACCTCTACCTACAATGCCCCCTCCAGTGTTGCCTCCTTCATTGCCACCACCAGTGATGCCCCCTGCCCTCCCTGCTACAGTGCCACCACCTGGCATGCCCCCACCTGTTATGCCACCTTCTCTACCAACCTCTGTTCCCCCACCAGGGATGCCTCCTTCTCTCTCTTCTGCAGGGCCACCACCAGTTCTCCCCCCACCTTCCCTGTCTTCTGCAGGGCCACCACCAGTTCTTCCCCCACCATCTCTCTCTTCAACAGCACCTCCACCTGTCATGCCCCTCCCACCATTGTCTTCAGCTACACCTCCTCCAGGAATACCTCCCCCTGGAGTTCCACAAGGGATACCTCCTCAGTTAACAGCAGCCCCAGTTCCACCAGCCTCCAGTTCACAGAGCTCGCAAGTTCCAGAGAAACCTAGACCAGCACTGCTTCCTACTCCTGTGTCTTTTGGTTCTGCCCCACCGACAACTTACCATCCTCCGTTGCAATCAGCTGGTCCATCAGAACAAGTGAATTCAAAAGCTCCTTTGAGCAAGTCTGCTCTGCCATACAGTTCATTCTCATCTGATCAAGGACTTGGGGAGTCTTCAGCTGCTCCATCTCAGCCAATCACTGCAGTGAAGGACATGCCAGTGAGATCAGGTGGCCTGCTTCCAGATCCTCCTAGAAGTAGTTACTTGGAAAGTCCAAGAGGCCCAAGATTTGATGGTCCTCGAAGATTTGAGGATTTAGGGTCAAGGTGTGAAGGACCGAGACCCAAAGGGCCTCGTTTTGAAGGAAATCGCCCCGATGGGCCAAGACCCAGATATGAAGGTCACCCAGCAGAGGGCACTAAAAGCAAGTGGGGAATGATTCCCCGGGGGCCAGCATCTCAATTTTATATTACCCCCAGTACATCCCTAAGTCCTCGACAGAGTGGACCACAGTGGAAAGGCCCCAAACCAGCTTTTGGACAGCAGCATCAGCAGCAACCTAAGTCACAAGCAGAACCTCTTTCAGGAAACAAAGAACCATTAGCAGACACCAGTAGTAACCAGCAGAAGAATTTTAAAATGCAATCAGCTGCATTTTCCATTGCTGCAGATGTAAAGGATGTCAAGGCGGCTCAGTCAAATGAGAATCTAAGCGACTCTCAACAAGAGCCACCTAAAAGTGAAGTCTCGGAAGGGCCCGTAGAGCCCTCTAATTGGGACCAGAATGTTCAAAGTATGGAGACTCAAATCGACAAAGCCCAAGCTGTTACTCAGCCTGTACCCCTTGCGAATAAGCCTGTACCTGCTCAATCTACTTTTCCTTCAAAAACAGGGGGGATGGAGGGAGGAACAGCAGTAGCAACATCATCATTAACAGCAGATAATGATTTTAAACCTGTGGGTATTGGTCTACCCCATTCAGAAAACAACCAAGATAAAGGCCTGCCTCGGCCAGATAATAGAGATAATAGATTAGAAGGCAATAGAGGCAACAGCTCATCTTACAGAGGTCCTGGGCAAAGCAGAATGGAAGACACACGGGATAAAGGTCTAGTAAACAGAGGTCGCGGCCAGGCAATCAGTCGAGGCCCAGGATTGGTCAAGCAAGAAGACTTTCGGGATAAGATGATGGGTAGAAGAGAAGATAGTCGAGAGAAGATGAACAGAGGAGAAGGTAGCCGGGACAGAGGGTTGGTGAGGCCTGGAAGCAGTCGGGAGAAAGTGCCAGGTGGTCTTCAAGGGAGCCAGGACAGGGGTGCAGCTGGCAGCCGAGAAAGGGGACCACCTCGGAGGGCTGGCAGTCAGGAGAGGGGACCTCTTCGAAGGGCTGGGAGTAGAGAGAGAATACCACCCCGAAGAGCTGGGAGCAGGGAGAGAGGACCACCTCGAGGGCCTGGCAGTCGAGAAAGGGGACTGGGAAGATCAGATTTTGGTCGTGATAGAGGTCCATTCAGACCAGAACCAGGAGATGGTGGGGAAAAAATGTATCCATATCACCGGGATGAGCCTCCTAGGGCTCCATGGAACCATGGAGAAGAGCGAGGGCATGAAGAGTTTCCATTAGATGGTAGAAATGCTCCAATGGAACGAGAAAGACTCGATGACTGGGATAGAGAGAGATACTGGAGAGAATGTGAACGTGACTATCAAGATGATACACTAGAGCTCTATAACAGAGAGGACAGGTTCTCAGCACCACCATCTCGGTCTCATGATGGAGATAGGCGAGGCCCTTGGTGGGATGATTGGGAGAGAGACCAGGATATGGATGAGGACTACAATAGGGAAATGGAAAGGGACATGGACAGGGATGTGGATCGGATTTCAAGACCTATGGATATGTATGATAGAAGTTTGGATAATGAGTGGGACAGAGATTATGGGAGACCACTGGATGAACAAGAATCACAGTTTCGTGAACGGGATATTCCATCTCTTCCACCTTTACCGCCCCTCCCACCTCTTCCACCTTTGGATAGATATCGGGATGATAGATGGAGAGAAGAAAGAAATCGAGAGCATGGGTATGATCGAGATTTCCGTGATAGGGGTGAGTTGAGGATTCGAGAGTATCCAGAAAGAGGAGATACATGGCGGGAAAAGCGAGATTATGTTCCTGACAGAATGGACTGGGAAAGAGAACGGTTGTCAGACAGATGGTACCCATCTGATGTGGATAGACATTCCCCCATGGCGGAACATATGCCCTCCTCACATCATTCCTCAGAAATGATGGGGTCCGATGCAAGCTTAGACTCTGACCAAGGCCTTGGAGGGGTAATGGTTCTCAGTCAGAGGCAGCATGAAATCATTTTGAAAGCTGCACAAGAACTGAAAATGCTTCGGGAACAGAAAGAACAGCTTCAAAAGATGAAAGACTTCGGGTCTGAGCCACAGATGGCTGACCATCTACCACCTCAGGAATCAAGATTGCAGAATACATCTTCAAGACCTGGAATGTATCCGCCTCCAGGGTCGTATAGACCTCCCCCTCCTATGGGCAAACCACCAGGTTCAATTGTAAGACCCTCTGCTCCACCAGCAAGATCATCTGTTCCTGTGACCAGGCCACCTGTCCCAATACCACCACCTCCACCTCCTCCACCTCTACCTCCTCCTCCTCCAGTGATAAAGCCACAAACTTCAGCTGTAGAACAGGAACGATGGGATGAAGATTCTTTCTATGGGCTCTGGGATACAAATGATGAACAAGGACTGAATTCAGAATTTAAGTCAGAAACTGCAGCAATTCCATCTGCTCCAGTATTACCACCCCCACCTGTTCACTCTTCCATTCCCCCTCCTGGCCCAGTGCCTATGGGTATGCCACCAATGTCCAAGCCACCACCAGTACAACAGACTGTTGATTATGGCCATGGCCGAGATATATCCACTAATAAAGTTGAACAGATACCTTATGGAGAAAGAATAACTCTACGCCCAGATCCACTACCTGAAAGATCAACTTTTGAGACAGAGCATGCAGGCCAACGTGATCGTTATGATAGAGAAAGAGATCGTGAGCCTTATTTTGATCGTCAAAGTAATGTCATAGCAGATCATCGAGATTTTAAAAGGGATCGTGAGACACATAGAGATCGAGACCGGGATCGTGGTGTTATTGACTATGACCGGGATCGATTTGACAGAGAACGCCGACCCCGAGATGATAGAGCTCAGTCATATCGAGACAAAAAAGACCATTCCTCATCCAGAAGAGGGGGTTTTGATAGGCCATCCTATGACCGGAAGTCTGACCGACCAGTCTATGAAGGACCATCCATGTTTGGAGGAGAACGAAGGACTTATCCTGAGGAGCGAATGCCTCTGCCAGCTCCTTCACTGAGCCACCAGCCACCTCCAGCTCCACGAGTCGAGAAGAAGCCTGAATCAAAGAATGTGGACGATATTTTGAAACCACCGGGCCGGGAGAGCAGACCTGAGAGAATTGTTGTTATAATGAGAGGATTACCTGGCAGTGGAAAGACACATGTTGCAAAACTTATTCGAGATAAGGAGGTAGAATTTGGAGGACCTGCACCCAGAGTTCTAAGCCTGGATGATTACTTCATCACTGAAGTGGAAAAAGAAGAAAAAGATCCAGATTCTGGAAAGAAAGTGAAAAAGAAGGTAATGGAATATGAATATGAAGCTGAGATGGAGGAGACTTACCGCACCAGCATGTTCAAAACTTTCAAAAAGACTCTGGATGATGGCTTTTTTCCCTTCATCATCCTGGATGCCATCAATGACAGAGTTAGGCATTTTGACCAGTTTTGGAGTGCAGCAAAAACCAAGGGATTTGAGGTATATTTGGCTGAAATGAGTGCAGATAACCAGACTTGTGGCAAGAGAAATATTCATGGAAGAAAGCTTAAAGAAATAAATAAGATGGCTGATCACTGGGAAACTGCACCTCGTCACATGATGCGTCTAGATATTCGTTCTTTGCTGCAAGATGCTGCTATTGAAGAGGTAGAGATGGAAGATTTTGATGCAAATATCGAAGAACAGAAAGAAGAAAAGAAAGATGCAGAGGAAGAGGAAAGCGAACTGGGTTACATTCCGAAAAGCAAATGGGAGATGGACACATCTGAGGCAAAGCTAGACAAGTTGGATGGCTTGAGGACTGGTACTAAAAGGAAACGTGACTGGGAGGCCATTGCCAGCAGAATGGAGGATTATCTTCAGCTCCCCGATGATTATGATACTCGTGCTTCTGAGCCTGGGAAGAAGAGGGTCAGATGGGCAGACCTGGAAGAGAAGAAGGATGCAGATAGGAAAAGGGCCATAGGTTTTGTGGTCGGACAGACTGATTGGGAGAAGATCACAGATGAAAGTGGTCACCTGGCTGAAAAAGCCCTCAATCGAACCAAATATATATGAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMYPNWGRYGGSSHYPPPPVPPPPPVALPEASPGPGYSSSTTPAAPSSSGFMSFREQHLAQLQQLQQMHQKQMQCV LQPHHLPPPPLPPPPVMPGGGYGDWQPPPPPMPPPPGPALSYQKQQQYKHQMLHHQRDGPPGLVPMELESPPESPPVPPGSYMPPSQSYMPPPQPPPSYY PPTSSQPYLPPAQPSPSQSPPSQSYLAPTPSYSSSSSSSQSYLSHSQSYLPSSQASPSRPSQGHSKSQLLAPPPPSAPPGNKTTVQQEPLESGAKNKSTE QQQAAPEPDPSTMTPQEQQQYWYRQHLLSLQQRTKVHLPGHKKGPVVAKDTPEPVKEEVTVPATSQVPESPSSEEPPLPPPNEEVPPPLPPEEPQSEDPE EDARLKQLQAAAAHWQQHQQHRVGFQYQGIMQKHTQLQQILQQYQQIIQPPPHIQTMSVDMQLRHYEMQQQQFQHLYQEWEREFQLWEEQLHSYPHKDQL QEYEKQWKTWQGHMKATQSYLQEKVNSFQNMKNQYMGNMSMPPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLPTSVPP PGMPPSLSSAGPPPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPPGVPQGIPPQLTAAPVPPASSSQSSQVPEKPRPALLPTPV SFGSAPPTTYHPPLQSAGPSEQVNSKAPLSKSALPYSSFSSDQGLGESSAAPSQPITAVKDMPVRSGGLLPDPPRSSYLESPRGPRFDGPRRFEDLGSRC EGPRPKGPRFEGNRPDGPRPRYEGHPAEGTKSKWGMIPRGPASQFYITPSTSLSPRQSGPQWKGPKPAFGQQHQQQPKSQAEPLSGNKEPLADTSSNQQK NFKMQSAAFSIAADVKDVKAAQSNENLSDSQQEPPKSEVSEGPVEPSNWDQNVQSMETQIDKAQAVTQPVPLANKPVPAQSTFPSKTGGMEGGTAVATSS LTADNDFKPVGIGLPHSENNQDKGLPRPDNRDNRLEGNRGNSSSYRGPGQSRMEDTRDKGLVNRGRGQAISRGPGLVKQEDFRDKMMGRREDSREKMNRG EGSRDRGLVRPGSSREKVPGGLQGSQDRGAAGSRERGPPRRAGSQERGPLRRAGSRERIPPRRAGSRERGPPRGPGSRERGLGRSDFGRDRGPFRPEPGD GGEKMYPYHRDEPPRAPWNHGEERGHEEFPLDGRNAPMERERLDDWDRERYWRECERDYQDDTLELYNREDRFSAPPSRSHDGDRRGPWWDDWERDQDMD EDYNREMERDMDRDVDRISRPMDMYDRSLDNEWDRDYGRPLDEQESQFRERDIPSLPPLPPLPPLPPLDRYRDDRWREERNREHGYDRDFRDRGELRIRE YPERGDTWREKRDYVPDRMDWERERLSDRWYPSDVDRHSPMAEHMPSSHHSSEMMGSDASLDSDQGLGGVMVLSQRQHEIILKAAQELKMLREQKEQLQK MKDFGSEPQMADHLPPQESRLQNTSSRPGMYPPPGSYRPPPPMGKPPGSIVRPSAPPARSSVPVTRPPVPIPPPPPPPPLPPPPPVIKPQTSAVEQERWD EDSFYGLWDTNDEQGLNSEFKSETAAIPSAPVLPPPPVHSSIPPPGPVPMGMPPMSKPPPVQQTVDYGHGRDISTNKVEQIPYGERITLRPDPLPERSTF ETEHAGQRDRYDRERDREPYFDRQSNVIADHRDFKRDRETHRDRDRDRGVIDYDRDRFDRERRPRDDRAQSYRDKKDHSSSRRGGFDRPSYDRKSDRPVY EGPSMFGGERRTYPEERMPLPAPSLSHQPPPAPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYF ITEVEKEEKDPDSGKKVKKKVMEYEYEAEMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGR KLKEINKMADHWETAPRHMMRLDIRSLLQDAAIEEVEMEDFDANIEEQKEEKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRDWEAIAS RMEDYLQLPDDYDTRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAEKALNRTKYI*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

ZAP3

cDNA Synonyms: 
C14orf170; PPP1R169; ZAP113; YLPM1
DU Number: 
DU67257
Plasmid: 
pcDNA5 FRT/TO 3FLAG ZAP3
Expressed: 
3FLAG ZAP3
Genbank: 
NM_019589.2 with one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGTACCCGAATTGGGGCCGGTATGGCGGGAGCAGCCACTATCCGCCGCCACCGGTCCCACCGCCGCCGCCAGTGGCGCTTCCTGAGGCCTCGCCGGGGCCCGGGTACTCGAGCTCGACGACTCCCGCGGCCCCCTCCTCCTCGGGCTTCATGAGCTTCCGCGAACAGCACTTGGCGCAGCTCCAGCAGCTGCAGCAGATGCACCAGAAGCAAATGCAGTGCGTGCTTCAGCCCCACCACCTTCCTCCGCCCCCTCTGCCGCCCCCGCCAGTGATGCCGGGGGGCGGCTACGGAGACTGGCAGCCGCCACCGCCACCGATGCCCCCGCCACCCGGGCCGGCCCTCAGCTATCAGAAGCAGCAGCAGTACAAACACCAGATGCTCCACCACCAACGAGACGGGCCTCCTGGTTTGGTTCCAATGGAGCTGGAATCCCCCCCTGAATCTCCCCCTGTGCCGCCTGGGTCCTATATGCCCCCATCTCAGTCTTACATGCCCCCACCTCAGCCGCCACCCTCTTACTACCCCCCGACCTCATCTCAGCCCTACCTGCCTCCTGCTCAGCCGTCCCCTTCGCAGTCCCCACCTTCCCAATCCTACCTGGCGCCCACCCCTTCTTACTCATCCTCCTCCTCTTCCTCGCAATCCTATTTGAGCCATTCCCAGTCCTACTTGCCCTCTTCTCAGGCATCTCCTTCCCGCCCCTCCCAGGGCCATTCTAAATCCCAACTACTAGCTCCACCACCACCGTCCGCCCCCCCTGGAAATAAGACAACTGTCCAGCAAGAGCCTTTGGAGAGTGGGGCCAAAAACAAGAGTACTGAACAGCAGCAAGCCGCCCCTGAGCCAGATCCCTCTACGATGACTCCACAGGAACAGCAGCAGTATTGGTATCGACAGCACTTGCTTAGTTTGCAACAGAGGACAAAAGTTCATTTGCCAGGACACAAAAAGGGTCCTGTGGTAGCAAAGGATACACCAGAGCCGGTAAAAGAAGAAGTTACAGTACCTGCCACCAGTCAAGTTCCAGAATCTCCTTCTTCTGAGGAGCCCCCATTGCCACCTCCAAATGAGGAAGTGCCACCTCCTCTCCCACCTGAGGAACCCCAGTCTGAGGACCCAGAAGAAGATGCCAGGTTAAAGCAGTTGCAGGCTGCAGCAGCACACTGGCAGCAGCACCAGCAGCATCGAGTCGGTTTCCAGTATCAGGGAATAATGCAGAAGCACACTCAGTTACAGCAGATTCTACAACAGTATCAGCAGATTATACAGCCCCCACCACATATACAGACCATGTCTGTAGATATGCAGCTGCGGCATTATGAGATGCAGCAGCAACAGTTTCAACATCTTTACCAAGAATGGGAGCGAGAGTTTCAGCTATGGGAGGAACAACTCCATTCCTATCCTCATAAAGATCAGCTTCAGGAGTATGAGAAGCAGTGGAAAACATGGCAGGGACATATGAAAGCCACTCAGAGCTATCTCCAGGAGAAAGTCAATTCATTTCAGAACATGAAGAACCAGTATATGGGGAACATGTCAATGCCACCTCCTTTTGTTCCATATTCTCAGATGCCTCCACCTCTACCTACAATGCCCCCTCCAGTGTTGCCTCCTTCATTGCCACCACCAGTGATGCCCCCTGCCCTCCCTGCTACAGTGCCACCACCTGGCATGCCCCCACCTGTTATGCCACCTTCTCTACCAACCTCTGTTCCCCCACCAGGGATGCCTCCTTCTCTCTCTTCTGCAGGGCCACCACCAGTTCTCCCCCCACCTTCCCTGTCTTCTGCAGGGCCACCACCAGTTCTTCCCCCACCATCTCTCTCTTCAACAGCACCTCCACCTGTCATGCCCCTCCCACCATTGTCTTCAGCTACACCTCCTCCAGGAATACCTCCCCCTGGAGTTCCACAAGGGATACCTCCTCAGTTAACAGCAGCCCCAGTTCCACCAGCCTCCAGTTCACAGAGCTCGCAAGTTCCAGAGAAACCTAGACCAGCACTGCTTCCTACTCCTGTGTCTTTTGGTTCTGCCCCACCGACAACTTACCATCCTCCGTTGCAATCAGCTGGTCCATCAGAACAAGTGAATTCAAAAGCTCCTTTGAGCAAGTCTGCTCTGCCATACAGTTCATTCTCATCTGATCAAGGACTTGGGGAGTCTTCAGCTGCTCCATCTCAGCCAATCACTGCAGTGAAGGACATGCCAGTGAGATCAGGTGGCCTGCTTCCAGATCCTCCTAGAAGTAGTTACTTGGAAAGTCCAAGAGGCCCAAGATTTGATGGTCCTCGAAGATTTGAGGATTTAGGGTCAAGGTGTGAAGGACCGAGACCCAAAGGGCCTCGTTTTGAAGGAAATCGCCCCGATGGGCCAAGACCCAGATATGAAGGTCACCCAGCAGAGGGCACTAAAAGCAAGTGGGGAATGATTCCCCGGGGGCCAGCATCTCAATTTTATATTACCCCCAGTACATCCCTAAGTCCTCGACAGAGTGGACCACAGTGGAAAGGCCCCAAACCAGCTTTTGGACAGCAGCATCAGCAGCAACCTAAGTCACAAGCAGAACCTCTTTCAGGAAACAAAGAACCATTAGCAGACACCAGTAGTAACCAGCAGAAGAATTTTAAAATGCAATCAGCTGCATTTTCCATTGCTGCAGATGTAAAGGATGTCAAGGCGGCTCAGTCAAATGAGAATCTAAGCGACTCTCAACAAGAGCCACCTAAAAGTGAAGTCTCGGAAGGGCCCGTAGAGCCCTCTAATTGGGACCAGAATGTTCAAAGTATGGAGACTCAAATCGACAAAGCCCAAGCTGTTACTCAGCCTGTACCCCTTGCGAATAAGCCTGTACCTGCTCAATCTACTTTTCCTTCAAAAACAGGGGGGATGGAGGGAGGAACAGCAGTAGCAACATCATCATTAACAGCAGATAATGATTTTAAACCTGTGGGTATTGGTCTACCCCATTCAGAAAACAACCAAGATAAAGGCCTGCCTCGGCCAGATAATAGAGATAATAGATTAGAAGGCAATAGAGGCAACAGCTCATCTTACAGAGGTCCTGGGCAAAGCAGAATGGAAGACACACGGGATAAAGGTCTAGTAAACAGAGGTCGCGGCCAGGCAATCAGTCGAGGCCCAGGATTGGTCAAGCAAGAAGACTTTCGGGATAAGATGATGGGTAGAAGAGAAGATAGTCGAGAGAAGATGAACAGAGGAGAAGGTAGCCGGGACAGAGGGTTGGTGAGGCCTGGAAGCAGTCGGGAGAAAGTGCCAGGTGGTCTTCAAGGGAGCCAGGACAGGGGTGCAGCTGGCAGCCGAGAAAGGGGACCACCTCGGAGGGCTGGCAGTCAGGAGAGGGGACCTCTTCGAAGGGCTGGGAGTAGAGAGAGAATACCACCCCGAAGAGCTGGGAGCAGGGAGAGAGGACCACCTCGAGGGCCTGGCAGTCGAGAAAGGGGACTGGGAAGATCAGATTTTGGTCGTGATAGAGGTCCATTCAGACCAGAACCAGGAGATGGTGGGGAAAAAATGTATCCATATCACCGGGATGAGCCTCCTAGGGCTCCATGGAACCATGGAGAAGAGCGAGGGCATGAAGAGTTTCCATTAGATGGTAGAAATGCTCCAATGGAACGAGAAAGACTCGATGACTGGGATAGAGAGAGATACTGGAGAGAATGTGAACGTGACTATCAAGATGATACACTAGAGCTCTATAACAGAGAGGACAGGTTCTCAGCACCACCATCTCGGTCTCATGATGGAGATAGGCGAGGCCCTTGGTGGGATGATTGGGAGAGAGACCAGGATATGGATGAGGACTACAATAGGGAAATGGAAAGGGACATGGACAGGGATGTGGATCGGATTTCAAGACCTATGGATATGTATGATAGAAGTTTGGATAATGAGTGGGACAGAGATTATGGGAGACCACTGGATGAACAAGAATCACAGTTTCGTGAACGGGATATTCCATCTCTTCCACCTTTACCGCCCCTCCCACCTCTTCCACCTTTGGATAGATATCGGGATGATAGATGGAGAGAAGAAAGAAATCGAGAGCATGGGTATGATCGAGATTTCCGTGATAGGGGTGAGTTGAGGATTCGAGAGTATCCAGAAAGAGGAGATACATGGCGGGAAAAGCGAGATTATGTTCCTGACAGAATGGACTGGGAAAGAGAACGGTTGTCAGACAGATGGTACCCATCTGATGTGGATAGACATTCCCCCATGGCGGAACATATGCCCTCCTCACATCATTCCTCAGAAATGATGGGGTCCGATGCAAGCTTAGACTCTGACCAAGGCCTTGGAGGGGTAATGGTTCTCAGTCAGAGGCAGCATGAAATCATTTTGAAAGCTGCACAAGAACTGAAAATGCTTCGGGAACAGAAAGAACAGCTTCAAAAGATGAAAGACTTCGGGTCTGAGCCACAGATGGCTGACCATCTACCACCTCAGGAATCAAGATTGCAGAATACATCTTCAAGACCTGGAATGTATCCGCCTCCAGGGTCGTATAGACCTCCCCCTCCTATGGGCAAACCACCAGGTTCAATTGTAAGACCCTCTGCTCCACCAGCAAGATCATCTGTTCCTGTGACCAGGCCACCTGTCCCAATACCACCACCTCCACCTCCTCCACCTCTACCTCCTCCTCCTCCAGTGATAAAGCCACAAACTTCAGCTGTAGAACAGGAACGATGGGATGAAGATTCTTTCTATGGGCTCTGGGATACAAATGATGAACAAGGACTGAATTCAGAATTTAAGTCAGAAACTGCAGCAATTCCATCTGCTCCAGTATTACCACCCCCACCTGTTCACTCTTCCATTCCCCCTCCTGGCCCAGTGCCTATGGGTATGCCACCAATGTCCAAGCCACCACCAGTACAACAGACTGTTGATTATGGCCATGGCCGAGATATATCCACTAATAAAGTTGAACAGATACCTTATGGAGAAAGAATAACTCTACGCCCAGATCCACTACCTGAAAGATCAACTTTTGAGACAGAGCATGCAGGCCAACGTGATCGTTATGATAGAGAAAGAGATCGTGAGCCTTATTTTGATCGTCAAAGTAATGTCATAGCAGATCATCGAGATTTTAAAAGGGATCGTGAGACACATAGAGATCGAGACCGGGATCGTGGTGTTATTGACTATGACCGGGATCGATTTGACAGAGAACGCCGACCCCGAGATGATAGAGCTCAGTCATATCGAGACAAAAAAGACCATTCCTCATCCAGAAGAGGGGGTTTTGATAGGCCATCCTATGACCGGAAGTCTGACCGACCAGTCTATGAAGGACCATCCATGTTTGGAGGAGAACGAAGGACTTATCCTGAGGAGCGAATGCCTCTGCCAGCTCCTTCACTGAGCCACCAGCCACCTCCAGCTCCACGAGTCGAGAAGAAGCCTGAATCAAAGAATGTGGACGATATTTTGAAACCACCGGGCCGGGAGAGCAGACCTGAGAGAATTGTTGTTATAATGAGAGGATTACCTGGCAGTGGAAAGACACATGTTGCAAAACTTATTCGAGATAAGGAGGTAGAATTTGGAGGACCTGCACCCAGAGTTCTAAGCCTGGATGATTACTTCATCACTGAAGTGGAAAAAGAAGAAAAAGATCCAGATTCTGGAAAGAAAGTGAAAAAGAAGGTAATGGAATATGAATATGAAGCTGAGATGGAGGAGACTTACCGCACCAGCATGTTCAAAACTTTCAAAAAGACTCTGGATGATGGCTTTTTTCCCTTCATCATCCTGGATGCCATCAATGACAGAGTTAGGCATTTTGACCAGTTTTGGAGTGCAGCAAAAACCAAGGGATTTGAGGTATATTTGGCTGAAATGAGTGCAGATAACCAGACTTGTGGCAAGAGAAATATTCATGGAAGAAAGCTTAAAGAAATAAATAAGATGGCTGATCACTGGGAAACTGCACCTCGTCACATGATGCGTCTAGATATTCGTTCTTTGCTGCAAGATGCTGCTATTGAAGAGGTAGAGATGGAAGATTTTGATGCAAATATCGAAGAACAGAAAGAAGAAAAGAAAGATGCAGAGGAAGAGGAAAGCGAACTGGGTTACATTCCGAAAAGCAAATGGGAGATGGACACATCTGAGGCAAAGCTAGACAAGTTGGATGGCTTGAGGACTGGTACTAAAAGGAAACGTGACTGGGAGGCCATTGCCAGCAGAATGGAGGATTATCTTCAGCTCCCCGATGATTATGATACTCGTGCTTCTGAGCCTGGGAAGAAGAGGGTCAGATGGGCAGACCTGGAAGAGAAGAAGGATGCAGATAGGAAAAGGGCCATAGGTTTTGTGGTCGGACAGACTGATTGGGAGAAGATCACAGATGAAAGTGGTCACCTGGCTGAAAAAGCCCTCAATCGAACCAAATATATATGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMYPNWGRYGGSSHYPPPPVPPPPPVALPEASPGPGYSSSTTPAAPSSSGFMSFREQHLAQLQQLQQMHQKQ MQCVLQPHHLPPPPLPPPPVMPGGGYGDWQPPPPPMPPPPGPALSYQKQQQYKHQMLHHQRDGPPGLVPMELESPPESPPVPPGSYMPPSQSYMPPPQPP PSYYPPTSSQPYLPPAQPSPSQSPPSQSYLAPTPSYSSSSSSSQSYLSHSQSYLPSSQASPSRPSQGHSKSQLLAPPPPSAPPGNKTTVQQEPLESGAKN KSTEQQQAAPEPDPSTMTPQEQQQYWYRQHLLSLQQRTKVHLPGHKKGPVVAKDTPEPVKEEVTVPATSQVPESPSSEEPPLPPPNEEVPPPLPPEEPQS EDPEEDARLKQLQAAAAHWQQHQQHRVGFQYQGIMQKHTQLQQILQQYQQIIQPPPHIQTMSVDMQLRHYEMQQQQFQHLYQEWEREFQLWEEQLHSYPH KDQLQEYEKQWKTWQGHMKATQSYLQEKVNSFQNMKNQYMGNMSMPPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLPT SVPPPGMPPSLSSAGPPPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPPGVPQGIPPQLTAAPVPPASSSQSSQVPEKPRPALL PTPVSFGSAPPTTYHPPLQSAGPSEQVNSKAPLSKSALPYSSFSSDQGLGESSAAPSQPITAVKDMPVRSGGLLPDPPRSSYLESPRGPRFDGPRRFEDL GSRCEGPRPKGPRFEGNRPDGPRPRYEGHPAEGTKSKWGMIPRGPASQFYITPSTSLSPRQSGPQWKGPKPAFGQQHQQQPKSQAEPLSGNKEPLADTSS NQQKNFKMQSAAFSIAADVKDVKAAQSNENLSDSQQEPPKSEVSEGPVEPSNWDQNVQSMETQIDKAQAVTQPVPLANKPVPAQSTFPSKTGGMEGGTAV ATSSLTADNDFKPVGIGLPHSENNQDKGLPRPDNRDNRLEGNRGNSSSYRGPGQSRMEDTRDKGLVNRGRGQAISRGPGLVKQEDFRDKMMGRREDSREK MNRGEGSRDRGLVRPGSSREKVPGGLQGSQDRGAAGSRERGPPRRAGSQERGPLRRAGSRERIPPRRAGSRERGPPRGPGSRERGLGRSDFGRDRGPFRP EPGDGGEKMYPYHRDEPPRAPWNHGEERGHEEFPLDGRNAPMERERLDDWDRERYWRECERDYQDDTLELYNREDRFSAPPSRSHDGDRRGPWWDDWERD QDMDEDYNREMERDMDRDVDRISRPMDMYDRSLDNEWDRDYGRPLDEQESQFRERDIPSLPPLPPLPPLPPLDRYRDDRWREERNREHGYDRDFRDRGEL RIREYPERGDTWREKRDYVPDRMDWERERLSDRWYPSDVDRHSPMAEHMPSSHHSSEMMGSDASLDSDQGLGGVMVLSQRQHEIILKAAQELKMLREQKE QLQKMKDFGSEPQMADHLPPQESRLQNTSSRPGMYPPPGSYRPPPPMGKPPGSIVRPSAPPARSSVPVTRPPVPIPPPPPPPPLPPPPPVIKPQTSAVEQ ERWDEDSFYGLWDTNDEQGLNSEFKSETAAIPSAPVLPPPPVHSSIPPPGPVPMGMPPMSKPPPVQQTVDYGHGRDISTNKVEQIPYGERITLRPDPLPE RSTFETEHAGQRDRYDRERDREPYFDRQSNVIADHRDFKRDRETHRDRDRDRGVIDYDRDRFDRERRPRDDRAQSYRDKKDHSSSRRGGFDRPSYDRKSD RPVYEGPSMFGGERRTYPEERMPLPAPSLSHQPPPAPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSL DDYFITEVEKEEKDPDSGKKVKKKVMEYEYEAEMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRN IHGRKLKEINKMADHWETAPRHMMRLDIRSLLQDAAIEEVEMEDFDANIEEQKEEKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRDWE AIASRMEDYLQLPDDYDTRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAEKALNRTKYI*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

ZNF592

cDNA Synonyms: 
CAMOS; SCAR5
DU Number: 
DU67251
Plasmid: 
pBabeD puro 3FLAG ZNF592
Expressed: 
3FLAG ZNF592
Genbank: 
NM_014630.2 with benign SNP S926N and one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGGGGGATATGAAAACCCCAGATTTTGATGACCTTCTGGCTGCCTTTGACATCCCAGACCCCACCAGCCTTGATGCCAAGGAGGCCATCCAGACACCCAGTGAGGAGAATGAGAGTCCCCTCAAACCTCCAGGCATATGTATGGATGAAAGTGTGTCCTTGTCTCACTCAGGATCAGCCCCCGATGTGCCGGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAGGAGTCATTTGAAGCGGAGAAAGACCACATTACTCCCAGTCTCCTACACAATGGATTCCGGGGCTCAGATCTGCCTCCAGATCCCCACAACTGTGGGAAATTTGATTCTACTTTTATGAATGGAGACAGTGCCAGGAGTTTCCCTGGCAAACTGGAGCCTCCCAAGTCAGAGCCATTACCCACCTTCAACCAGTTCAGTCCAATCTCCAGCCCAGAACCTGAGGATCCCATCAAAGATAACGGATTTGGGATAAAGCCCAAACACTCTGACAGTTATTTCCCACCCCCTCTTGGGTGCGGGGCTGTGGGAGGCCCAGTCCTGGAGGCTCTGGCTAAGTTTCCGGTTCCAGAGCTGCATATGTTTGATCATTTTTGTAAGAAAGAACCCAAGCCAGAACCCCTGCCCTTGGGGAGCCAGCAGGAACACGAGCAAAGTGGGCAGAACACAGTGGAACCTCACAAGGATCCGGATGCCACTCGATTCTTCGGGGAAGCTTTGGAGTTCAACAGCCATCCTAGCAACAGTATTGGAGAGTCCAAGGGGCTTGCCCGGGAGCTTGGTACCTGCTCATCAGTCCCCCCTAGGCAGCGTCTAAAGCCAGCTCATTCCAAGCTGTCCTCTTGTGTGGCAGCCTTGGTGGCCTTGCAGGCCAAAAGAGTGGCTAGTGTCACTAAGGAGGATCAGCCTGGCCACACAAAGGATCTCTCAGGGCCCACTAAAGAGAGTTCTAAAGGTAGCCCCAAAATGCCCAAGTCACCAAAGAGTCCCCGGAGCCCTCTGGAGGCCACTAGAAAAAGTATCAAGCCATCGGACAGCCCTCGTAGCATCTGCAGTGACAGCAGCAGCAAAGGCTCACCGTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTGAGAATCAAAACCATTAAGACATCATCAGGGGAAATCAAACGGACTGTCACAAGGATCCTGCCAGATCCTGATGATCCAAGTAAGTCCCCTGTTGGGTCACCTCTAGGGAGCGCCATTGCAGAGGCCCCCAGCGAGATGCCAGGGGATGAGGTGCCTGTGGAAGAGCACTTTCCTGAGGCAGGCACAAATTCAGGGAGCCCCCAGGGGGCCAGGAAAGGGGACGAGAGCATGACAAAGGCCAGTGACTCGTCATCTCCCAGCTGCAGTTCTGGGCCCCGGGTCCCAAAGGGGGCTGCCCCAGGCTCACAGACAGGCAAGAAGCAACAGAGCACAGCACTGCAGGCATCCACCCTGGCCCCTGCCAACCTCCTGCCCAAAGCCGTGCACTTGGCCAACCTGAACCTCGTCCCCCACAGTGTTGCTGCATCAGTGACAGCCAAGTCTTCAGTGCAAAGACGGAGCCAGCCACAGCTTACACAAATGTCGGTGCCCCTGGTCCACCAGGTGAAAAAGGCTGCCCCACTGATTGTAGAGGTCTTCAACAAGGTCCTTCACAGCTCCAACCCCGTGCCCCTCTATGCGCCAAATCTCAGCCCGCCTGCGGACAGCAGGATCCACGTGCCGGCCAGTGGGTACTGCTGCCTGGAGTGTGGAGACGCATTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATGGCCGGCGGAGCGTCCACATTGAGGTACTGTGCACACTGTGCTCCAAGACGCTGCTCTTCTTCAACAAGTGCAGCCTGCTCCGGCACGCCCGTGACCACAAGAGCAAGGGGCTCGTCATGCAGTGTTCCCAGCTGCTGGTGAAGCCTATCTCTGCGGACCAAATGTTCGTGTCGGCCCCTGTGAACTCCACGGCACCAGCAGCCCCAGCCCCTTCATCCTCTCCCAAACATGGCCTCACTTCGGGCAGTGCCAGTCCCCCTCCTCCAGCCTTGCCACTCTACCCAGACCCTGTGAGGCTCATCCGGTACTCAATCAAGTGTCTTGAATGTCACAAGCAGATGCGGGACTACATGGTCCTGGCTGCACATTTCCAGAGGACAACAGAGGAGACAGAGGGGCTGACCTGCCAGGTATGCCAGATGCTGCTGCCCAACCAGTGCAGTTTCTGTGCCCACCAGCGGATTCATGCACACAAGTCCCCCTACTGCTGCCCGGAGTGTGGGGTCCTCTGCCGCTCTGCCTACTTCCAGACCCATGTAAAGGAGAATTGCCTGCACTATGCCCGCAAGGTGGGCTACAGGTGCATCCACTGTGGTGTCGTCCACCTGACCTTGGCCTTGCTGAAAAGCCACATCCAGGAGCGACACTGCCAGGTTTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTGCCAGCAGCACTGCAGACCACAGTGCCACCCAGCACCCCACCCAGCCCCACAGACCCTCCCAGCTCATTTATAAGTGCTCCTGTGAAATGGTCTTCAACAAGAAGAGGCACATTCAGCAGCATTTTTACCAGAATGTCAGCAAGACGCAGGTGGGCGTCTTCAAGTGCCCTGAGTGCCCACTCTTGTTCGTGCAGAAGCCGGAGTTGATGCAACACGTCAAGAGCACCCACGGTGTTCCCCGAAATGTGGACGAGCTGTCAAACCTCCAGTCTTCAGCGGACACATCCTCAAGCCGCCCTGGCTCTCGAGTTCCCACTGAGCCACCAGCCACTAGTGTGGCTGCTCGGAGCAGCTCCCTGCCTTCTGGCCGCTGGGGTAGGCCTGAAGCCCACCGCAGGGTGGAAGCCAGGCCGCGGCTGAGGAACACTGGCTGGACCTGCCAGGAGTGCCAGGAGTGGGTTCCAGATCGGGAGAGCTACGTGTCCCACATGAAAAAGAGCCACGGTCGGACATTGAAGCGGTACCCATGCCGGCAGTGTGAACAGTCCTTCCACACCCCCAACAGCCTGCGCAAACACATCCGCAACAACCATGACACAGTAAAGAAGTTCTACACCTGCGGGTACTGCACAGAGGACAGCCCCAGCTTTCCTCGGCCCTCCCTTCTGGAGAGCCACATCAGCCTTATGCATGGCATCAGAAACCCTGATTTGAGCCAGACGTCCAAAGTGAAACCTCCGGGTGGACATTCCCCTCAGGTGAACCATCTGAAAAGACCAGTCAGTGGAGTGGGGGACGCTCCAGGCACCAGCAATGGCGCAACTGTCTCTTCCACCAAAAGGCACAAGTCCCTTTTTCAGTGCGCGAAATGTAGTTTTGCCACAGACTCGGGGCTCGAGTTTCAGAGCCACATACCTCAGCACCAGGTGGACAGCTCCACAGCCCAATGTCTCCTCTGTGGTTTGTGCTACACCTCTGCCAGCTCCCTCAGCCGCCACCTCTTCATTGTCCACAAGGTGAGAGACCAGGAGGAGGAGGAGGAAGAGGAGGCGGCGGCAGCGGAGATGGCAGTGGAGGTGGCAGAGCCAGAGGAGGGCTCCGGGGAGGAGGTGCCCATGGAGACTAGAGAGAATGGACTGGAAGAATGTGCCGGTGAGCCTTTGTCAGCTGACCCAGAGGCGAGGAGATTGCTGGGCCCGGCCCCTGAGGACGATGGTGGCCACAATGATCACAGTCAACCACAGGCCTCTCAGGACCAGGACAGCCACACACTGTCCCCTCAGGTGTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSSEFMGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIVKN TSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPP LGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEALEFNSHPSNSIGESKGLARELGTCSSVPPRQ RLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKGSPSVAASSPPAI PKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSEMPGDEVPVEEHFPEAGTNSGSPQGARKGDESMTKASDSSSPSCSSGPRVPKG AAPGSQTGKKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPLVHQVKKAAPLIVEVFNKVLHSSNPVPLYAPNL SPPADSRIHVPASGYCCLECGDAFALEKSLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLLVKPISADQMFVSAPVNSTAP AAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQMRDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQCSFCAHQRIHAHKSPYCCPE CGVLCRSAYFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTASSTADHSATQHPTQPHRPSQLIYKCSCEMVFNK KRHIQQHFYQNVSKTQVGVFKCPECPLLFVQKPELMQHVKSTHGVPRNVDELSNLQSSADTSSSRPGSRVPTEPPATSVAARSSSLPSGRWGRPEAHRRV EARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQSFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDSPSFPRPSLLESHISLMHGIR NPDLSQTSKVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQSHIPQHQVDSSTAQCLLCGLCYTSASSLSRHL FIVHKVRDQEEEEEEEAAAAEMAVEVAEPEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQPQASQDQDSHTLSPQV*
Price: £125.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

ZNF592

cDNA Synonyms: 
CAMOS; SCAR5
DU Number: 
DU67250
Plasmid: 
pcDNA5 FRT/TO 3FLAG ZNF592
Expressed: 
3FLAG ZNF592
Genbank: 
NM_014630.2 with benign SNP S926N and one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGGGGGATATGAAAACCCCAGATTTTGATGACCTTCTGGCTGCCTTTGACATCCCAGACCCCACCAGCCTTGATGCCAAGGAGGCCATCCAGACACCCAGTGAGGAGAATGAGAGTCCCCTCAAACCTCCAGGCATATGTATGGATGAAAGTGTGTCCTTGTCTCACTCAGGATCAGCCCCCGATGTGCCGGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAGGAGTCATTTGAAGCGGAGAAAGACCACATTACTCCCAGTCTCCTACACAATGGATTCCGGGGCTCAGATCTGCCTCCAGATCCCCACAACTGTGGGAAATTTGATTCTACTTTTATGAATGGAGACAGTGCCAGGAGTTTCCCTGGCAAACTGGAGCCTCCCAAGTCAGAGCCATTACCCACCTTCAACCAGTTCAGTCCAATCTCCAGCCCAGAACCTGAGGATCCCATCAAAGATAACGGATTTGGGATAAAGCCCAAACACTCTGACAGTTATTTCCCACCCCCTCTTGGGTGCGGGGCTGTGGGAGGCCCAGTCCTGGAGGCTCTGGCTAAGTTTCCGGTTCCAGAGCTGCATATGTTTGATCATTTTTGTAAGAAAGAACCCAAGCCAGAACCCCTGCCCTTGGGGAGCCAGCAGGAACACGAGCAAAGTGGGCAGAACACAGTGGAACCTCACAAGGATCCGGATGCCACTCGATTCTTCGGGGAAGCTTTGGAGTTCAACAGCCATCCTAGCAACAGTATTGGAGAGTCCAAGGGGCTTGCCCGGGAGCTTGGTACCTGCTCATCAGTCCCCCCTAGGCAGCGTCTAAAGCCAGCTCATTCCAAGCTGTCCTCTTGTGTGGCAGCCTTGGTGGCCTTGCAGGCCAAAAGAGTGGCTAGTGTCACTAAGGAGGATCAGCCTGGCCACACAAAGGATCTCTCAGGGCCCACTAAAGAGAGTTCTAAAGGTAGCCCCAAAATGCCCAAGTCACCAAAGAGTCCCCGGAGCCCTCTGGAGGCCACTAGAAAAAGTATCAAGCCATCGGACAGCCCTCGTAGCATCTGCAGTGACAGCAGCAGCAAAGGCTCACCGTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTGAGAATCAAAACCATTAAGACATCATCAGGGGAAATCAAACGGACTGTCACAAGGATCCTGCCAGATCCTGATGATCCAAGTAAGTCCCCTGTTGGGTCACCTCTAGGGAGCGCCATTGCAGAGGCCCCCAGCGAGATGCCAGGGGATGAGGTGCCTGTGGAAGAGCACTTTCCTGAGGCAGGCACAAATTCAGGGAGCCCCCAGGGGGCCAGGAAAGGGGACGAGAGCATGACAAAGGCCAGTGACTCGTCATCTCCCAGCTGCAGTTCTGGGCCCCGGGTCCCAAAGGGGGCTGCCCCAGGCTCACAGACAGGCAAGAAGCAACAGAGCACAGCACTGCAGGCATCCACCCTGGCCCCTGCCAACCTCCTGCCCAAAGCCGTGCACTTGGCCAACCTGAACCTCGTCCCCCACAGTGTTGCTGCATCAGTGACAGCCAAGTCTTCAGTGCAAAGACGGAGCCAGCCACAGCTTACACAAATGTCGGTGCCCCTGGTCCACCAGGTGAAAAAGGCTGCCCCACTGATTGTAGAGGTCTTCAACAAGGTCCTTCACAGCTCCAACCCCGTGCCCCTCTATGCGCCAAATCTCAGCCCGCCTGCGGACAGCAGGATCCACGTGCCGGCCAGTGGGTACTGCTGCCTGGAGTGTGGAGACGCATTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATGGCCGGCGGAGCGTCCACATTGAGGTACTGTGCACACTGTGCTCCAAGACGCTGCTCTTCTTCAACAAGTGCAGCCTGCTCCGGCACGCCCGTGACCACAAGAGCAAGGGGCTCGTCATGCAGTGTTCCCAGCTGCTGGTGAAGCCTATCTCTGCGGACCAAATGTTCGTGTCGGCCCCTGTGAACTCCACGGCACCAGCAGCCCCAGCCCCTTCATCCTCTCCCAAACATGGCCTCACTTCGGGCAGTGCCAGTCCCCCTCCTCCAGCCTTGCCACTCTACCCAGACCCTGTGAGGCTCATCCGGTACTCAATCAAGTGTCTTGAATGTCACAAGCAGATGCGGGACTACATGGTCCTGGCTGCACATTTCCAGAGGACAACAGAGGAGACAGAGGGGCTGACCTGCCAGGTATGCCAGATGCTGCTGCCCAACCAGTGCAGTTTCTGTGCCCACCAGCGGATTCATGCACACAAGTCCCCCTACTGCTGCCCGGAGTGTGGGGTCCTCTGCCGCTCTGCCTACTTCCAGACCCATGTAAAGGAGAATTGCCTGCACTATGCCCGCAAGGTGGGCTACAGGTGCATCCACTGTGGTGTCGTCCACCTGACCTTGGCCTTGCTGAAAAGCCACATCCAGGAGCGACACTGCCAGGTTTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTGCCAGCAGCACTGCAGACCACAGTGCCACCCAGCACCCCACCCAGCCCCACAGACCCTCCCAGCTCATTTATAAGTGCTCCTGTGAAATGGTCTTCAACAAGAAGAGGCACATTCAGCAGCATTTTTACCAGAATGTCAGCAAGACGCAGGTGGGCGTCTTCAAGTGCCCTGAGTGCCCACTCTTGTTCGTGCAGAAGCCGGAGTTGATGCAACACGTCAAGAGCACCCACGGTGTTCCCCGAAATGTGGACGAGCTGTCAAACCTCCAGTCTTCAGCGGACACATCCTCAAGCCGCCCTGGCTCTCGAGTTCCCACTGAGCCACCAGCCACTAGTGTGGCTGCTCGGAGCAGCTCCCTGCCTTCTGGCCGCTGGGGTAGGCCTGAAGCCCACCGCAGGGTGGAAGCCAGGCCGCGGCTGAGGAACACTGGCTGGACCTGCCAGGAGTGCCAGGAGTGGGTTCCAGATCGGGAGAGCTACGTGTCCCACATGAAAAAGAGCCACGGTCGGACATTGAAGCGGTACCCATGCCGGCAGTGTGAACAGTCCTTCCACACCCCCAACAGCCTGCGCAAACACATCCGCAACAACCATGACACAGTAAAGAAGTTCTACACCTGCGGGTACTGCACAGAGGACAGCCCCAGCTTTCCTCGGCCCTCCCTTCTGGAGAGCCACATCAGCCTTATGCATGGCATCAGAAACCCTGATTTGAGCCAGACGTCCAAAGTGAAACCTCCGGGTGGACATTCCCCTCAGGTGAACCATCTGAAAAGACCAGTCAGTGGAGTGGGGGACGCTCCAGGCACCAGCAATGGCGCAACTGTCTCTTCCACCAAAAGGCACAAGTCCCTTTTTCAGTGCGCGAAATGTAGTTTTGCCACAGACTCGGGGCTCGAGTTTCAGAGCCACATACCTCAGCACCAGGTGGACAGCTCCACAGCCCAATGTCTCCTCTGTGGTTTGTGCTACACCTCTGCCAGCTCCCTCAGCCGCCACCTCTTCATTGTCCACAAGGTGAGAGACCAGGAGGAGGAGGAGGAAGAGGAGGCGGCGGCAGCGGAGATGGCAGTGGAGGTGGCAGAGCCAGAGGAGGGCTCCGGGGAGGAGGTGCCCATGGAGACTAGAGAGAATGGACTGGAAGAATGTGCCGGTGAGCCTTTGTCAGCTGACCCAGAGGCGAGGAGATTGCTGGGCCCGGCCCCTGAGGACGATGGTGGCCACAATGATCACAGTCAACCACAGGCCTCTCAGGACCAGGACAGCCACACACTGTCCCCTCAGGTGTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSPEFMGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSV IVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSY FPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEALEFNSHPSNSIGESKGLARELGTCSSV PPRQRLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKGSPSVAASS PPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSEMPGDEVPVEEHFPEAGTNSGSPQGARKGDESMTKASDSSSPSCSSGPR VPKGAAPGSQTGKKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPLVHQVKKAAPLIVEVFNKVLHSSNPVPLY APNLSPPADSRIHVPASGYCCLECGDAFALEKSLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLLVKPISADQMFVSAPVN STAPAAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQMRDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQCSFCAHQRIHAHKSPY CCPECGVLCRSAYFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTASSTADHSATQHPTQPHRPSQLIYKCSCEM VFNKKRHIQQHFYQNVSKTQVGVFKCPECPLLFVQKPELMQHVKSTHGVPRNVDELSNLQSSADTSSSRPGSRVPTEPPATSVAARSSSLPSGRWGRPEA HRRVEARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQSFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDSPSFPRPSLLESHISLM HGIRNPDLSQTSKVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQSHIPQHQVDSSTAQCLLCGLCYTSASSL SRHLFIVHKVRDQEEEEEEEAAAAEMAVEVAEPEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQPQASQDQDSHTLSPQV*
Price: £125.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

MPLKIP

cDNA Synonyms: 
TTDN1; ABHS; C7orf11; ORF20; TTD4
DU Number: 
DU67233
Plasmid: 
pBabeD puro 3FLAG MPLKIP
Expressed: 
3FLAG MPLKIP
Genbank: 
NM_138701.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCAGCGACAGAATTTTCGGCCCCCAACTCCTCCTTACCCTGGTCCGGGTGGAGGAGGTTGGGGTAGCGGAAGCAGCTTCCGGGGAACCCCGGGCGGGGGCGGACCACGGCCGCCCTCCCCTCGAGACGGGTACGGGAGTCCGCACCACACGCCGCCGTACGGGCCCCGGTCTAGGCCGTACGGGAGCAGTCACTCTCCGCGACACGGCGGCAGCTTCCCGGGGGGCCGGTTCGGGTCTCCGTCCCCTGGCGGCTACCCTGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCAGCAATTCGGCTACTCCCCAGGGCAGCAGCAGACCCACCCCCAGGGTTCTCCAAGGACATCTACACCATTTGGATCAGGGCGTGTTAGAGAAAAAAGAATGTCTAATGAGTTGGAAAATTATTTCAAGCCTTCAATGCTTGAAGATCCTTGGGCTGGCCTAGAACCAGTATCTGTAGTGGATATAAGCCAACAATACAGCAATACTCAAACATTCACAGGCAAAAAAGGAAGATACTTTTGTTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPG GRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKG RYFC*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

ELOA

cDNA Synonyms: 
TCEB3
DU Number: 
DU67228
Plasmid: 
pBabeD puro 3FLAG ELOA
Expressed: 
3FLAG ELOA
Genbank: 
NM_003198.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
ggatccATGCACGGAGGGCGGAGCTGCGGCCCGAGGACGCGACGCGAGCCCAGTTCCGGCGAGGAGGCCGCGCCAGTGACAGCGATGGCGGCGGAGTCGGCGCTCCAAGTTGTGGAGAAGCTGCAGGCGCGCCTGGCCGCGAACCCGGACCCTAAGAAGCTATTGAAATATTTGAAGAAACTCTCCACCCTGCCTATTACAGTAGACATTCTTGCGGAGACTGGGGTTGGGAAAACAGTAAATAGCTTGCGAAAACACGAGCATGTTGGAAGCTTTGCCAGGGACCTAGTGGCCCAGTGGAAGAAGCTGGTTCCTGTGGAACGAAATGCTGAGCCTGATGAACAGGACTTTGAGAAGAGCAATTCCCGAAAGCGCCCTCGGGATGCCCTGCAGAAGGAGGAGGAGATGGAGGGGGACTACCAAGAAACCTGGAAAGCCACGGGGAGCCGATCCTATAGCCCTGACCACAGGCAGAAGAAACATAGGAAACTCTCGGAGCTCGAGAGACCTCACAAAGTGTCTCACGGTCATGAGAGGAGAGATGAGAGAAAGAGGTGTCACAGAATGTCACCAACTTACTCTTCAGACCCTGAGTCTTCTGATTATGGCCATGTTCAATCCCCTCCATCTTGTACCAGTCCTCATCAGATGTACGTCGACCACTACAGATCCCTGGAGGAGGACCAGGAGCCCATTGTTTCACACCAGAAGCCTGGGAAAGGCCACAGCAATGCCTTTCAGGACAGACTCGGGGCCAGCCAAGAACGACACCTGGGTGAACCCCATGGGAAAGGGGTTGTGAGTCAAAACAAGGAGCACAAATCTTCCCACAAGGACAAACGCCCCGTGGATGCCAAGAGTGATGAGAAGGCCTCTGTGGTGAGCAGAGAGAAATCACACAAGGCCCTCTCCAAAGAGGAGAACCGAAGGCCACCCTCAGGGGACAATGCAAGGGAGAAACCGCCCTCTAGTGGCGTAAAGAAAGAGAAGGACAGAGAGGGCAGCAGCCTGAAGAAGAAGTGTTTGCCTCCCTCAGAGGCCGCTTCAGACAACCACCTGAAAAAGCCAAAGCACAGAGACCCAGAGAAAGCCAAATTGGACAAAAGCAAGCAAGGTCTGGACAGCTTTGACACAGGAAAAGGAGCAGGAGACCTGTTGCCCAAGGTAAAAGAGAAGGGTTCTAACAACCTAAAGACTCCAGAAGGGAAAGTCAAAACTAATTTGGATAGAAAGTCACTGGGCTCCCTCCCTAAAGTTGAGGAGACAGATATGGAGGATGAATTCGAGCAGCCAACCATGTCTTTTGAATCCTACCTCAGCTATGACCAGCCCCGGAAGAAAAAGAAAAAGATTGTGAAAACTTCAGCCACGGCACTTGGAGATAAAGGACTTAAAAAAAATGACTCTAAAAGCACTGGTAAAAACTTGGACTCAGTTCAGAAATTACCCAAGGTGAACAAAACCAAGTCAGAGAAGCCGGCTGGAGCTGATTTAGCCAAGCTGAGAAAGGTGCCTGATGTGTTGCCAGTGTTGCCAGACCTCCCGTTACCCGCGATACAGGCCAATTACCGTCCACTGCCTTCCCTCGAGCTGATATCCTCCTTCCAGCCAAAGCGAAAAGCGTTCTCTTCACCCCAGGAAGAAGAAGAAGCTGGATTTACTGGGCGCAGAATGAATTCCAAGATGCAGGTGTATTCTGGTTCCAAGTGTGCCTATCTCCCTAAAATGATGACCTTGCACCAGCAATGCATCCGAGTACTTAAAAACAACATCGATTCAATCTTTGAAGTGGGAGGAGTCCCATACTCTGTTCTTGAACCCGTTTTGGAGAGGTGTACACCTGATCAGCTGTATCGCATAGAGGAATACAATCATGTATTAATTGAAGAAACAGATCAATTATGGAAAGTTCATTGTCACCGAGACTTTAAGGAAGAAAGACCCGAAGAGTATGAGTCGTGGCGAGAGATGTACCTGCGGCTTCAGGACGCCCGAGAGCAGCGGCTACGAGTACTAACAAAGAATATCCAGTTCGCACATGCCAATAAGCCCAAAGGCCGACAAGCAAAGATGGCCTTTGTCAACTCTGTGGCCAAGCCACCTCGTGACGTCCGGAGGAGGCAGGAAAAGTTTGGAACGGGAGGAGCAGCTGTCCCTGAGAAAATCAAGATCAAGCCAGCCCCGTACCCCATGGGAAGCAGCCATGCTTCCGCCAGTAGCATCAGCTTTAACCCCAGCCCTGAGGAGCCGGCCTATGATGGCCCAAGCACCAGCAGTGCCCACTTGGCACCAGTGGTCAGCAGCACTGTTTCCTATGATCCTAGGAAACCCACTGTGAAGAAAATTGCCCCAATGATGGCCAAGACAATTAAAGCTTTCAAGAACAGATTCTCCCGACGATAAgcggccgc
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMHGGRSCGPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLAANPDPKKLLKYLKKLSTLPITVDILAETGVG KTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGH ERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMYVDHYRSLEEDQEPIVSHQKPGKGHSNAFQDRLGASQERHLGEPHGKGVVSQNKEHKSSH KDKRPVDAKSDEKASVVSREKSHKALSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPEKAKLDKSKQGLDSFD TGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEETDMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTGKNLD SVQKLPKVNKTKSEKPAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAFSSPQEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMM TLHQQCIRVLKNNIDSIFEVGGVPYSVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKEERPEEYESWREMYLRLQDAREQRLRVLTKNIQ FAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKIKIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSYDPRKP TVKKIAPMMAKTIKAFKNRFSRR*
Price: £125.00
Completion Time: 
17
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

ELOA

cDNA Synonyms: 
TCEB3
DU Number: 
DU67227
Plasmid: 
pcDNA5 FRT/TO 3FLAG ELOA
Expressed: 
3FLAG ELOA
Genbank: 
NM_003198.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
ggatccATGCACGGAGGGCGGAGCTGCGGCCCGAGGACGCGACGCGAGCCCAGTTCCGGCGAGGAGGCCGCGCCAGTGACAGCGATGGCGGCGGAGTCGGCGCTCCAAGTTGTGGAGAAGCTGCAGGCGCGCCTGGCCGCGAACCCGGACCCTAAGAAGCTATTGAAATATTTGAAGAAACTCTCCACCCTGCCTATTACAGTAGACATTCTTGCGGAGACTGGGGTTGGGAAAACAGTAAATAGCTTGCGAAAACACGAGCATGTTGGAAGCTTTGCCAGGGACCTAGTGGCCCAGTGGAAGAAGCTGGTTCCTGTGGAACGAAATGCTGAGCCTGATGAACAGGACTTTGAGAAGAGCAATTCCCGAAAGCGCCCTCGGGATGCCCTGCAGAAGGAGGAGGAGATGGAGGGGGACTACCAAGAAACCTGGAAAGCCACGGGGAGCCGATCCTATAGCCCTGACCACAGGCAGAAGAAACATAGGAAACTCTCGGAGCTCGAGAGACCTCACAAAGTGTCTCACGGTCATGAGAGGAGAGATGAGAGAAAGAGGTGTCACAGAATGTCACCAACTTACTCTTCAGACCCTGAGTCTTCTGATTATGGCCATGTTCAATCCCCTCCATCTTGTACCAGTCCTCATCAGATGTACGTCGACCACTACAGATCCCTGGAGGAGGACCAGGAGCCCATTGTTTCACACCAGAAGCCTGGGAAAGGCCACAGCAATGCCTTTCAGGACAGACTCGGGGCCAGCCAAGAACGACACCTGGGTGAACCCCATGGGAAAGGGGTTGTGAGTCAAAACAAGGAGCACAAATCTTCCCACAAGGACAAACGCCCCGTGGATGCCAAGAGTGATGAGAAGGCCTCTGTGGTGAGCAGAGAGAAATCACACAAGGCCCTCTCCAAAGAGGAGAACCGAAGGCCACCCTCAGGGGACAATGCAAGGGAGAAACCGCCCTCTAGTGGCGTAAAGAAAGAGAAGGACAGAGAGGGCAGCAGCCTGAAGAAGAAGTGTTTGCCTCCCTCAGAGGCCGCTTCAGACAACCACCTGAAAAAGCCAAAGCACAGAGACCCAGAGAAAGCCAAATTGGACAAAAGCAAGCAAGGTCTGGACAGCTTTGACACAGGAAAAGGAGCAGGAGACCTGTTGCCCAAGGTAAAAGAGAAGGGTTCTAACAACCTAAAGACTCCAGAAGGGAAAGTCAAAACTAATTTGGATAGAAAGTCACTGGGCTCCCTCCCTAAAGTTGAGGAGACAGATATGGAGGATGAATTCGAGCAGCCAACCATGTCTTTTGAATCCTACCTCAGCTATGACCAGCCCCGGAAGAAAAAGAAAAAGATTGTGAAAACTTCAGCCACGGCACTTGGAGATAAAGGACTTAAAAAAAATGACTCTAAAAGCACTGGTAAAAACTTGGACTCAGTTCAGAAATTACCCAAGGTGAACAAAACCAAGTCAGAGAAGCCGGCTGGAGCTGATTTAGCCAAGCTGAGAAAGGTGCCTGATGTGTTGCCAGTGTTGCCAGACCTCCCGTTACCCGCGATACAGGCCAATTACCGTCCACTGCCTTCCCTCGAGCTGATATCCTCCTTCCAGCCAAAGCGAAAAGCGTTCTCTTCACCCCAGGAAGAAGAAGAAGCTGGATTTACTGGGCGCAGAATGAATTCCAAGATGCAGGTGTATTCTGGTTCCAAGTGTGCCTATCTCCCTAAAATGATGACCTTGCACCAGCAATGCATCCGAGTACTTAAAAACAACATCGATTCAATCTTTGAAGTGGGAGGAGTCCCATACTCTGTTCTTGAACCCGTTTTGGAGAGGTGTACACCTGATCAGCTGTATCGCATAGAGGAATACAATCATGTATTAATTGAAGAAACAGATCAATTATGGAAAGTTCATTGTCACCGAGACTTTAAGGAAGAAAGACCCGAAGAGTATGAGTCGTGGCGAGAGATGTACCTGCGGCTTCAGGACGCCCGAGAGCAGCGGCTACGAGTACTAACAAAGAATATCCAGTTCGCACATGCCAATAAGCCCAAAGGCCGACAAGCAAAGATGGCCTTTGTCAACTCTGTGGCCAAGCCACCTCGTGACGTCCGGAGGAGGCAGGAAAAGTTTGGAACGGGAGGAGCAGCTGTCCCTGAGAAAATCAAGATCAAGCCAGCCCCGTACCCCATGGGAAGCAGCCATGCTTCCGCCAGTAGCATCAGCTTTAACCCCAGCCCTGAGGAGCCGGCCTATGATGGCCCAAGCACCAGCAGTGCCCACTTGGCACCAGTGGTCAGCAGCACTGTTTCCTATGATCCTAGGAAACCCACTGTGAAGAAAATTGCCCCAATGATGGCCAAGACAATTAAAGCTTTCAAGAACAGATTCTCCCGACGATAAgcggccgc
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMHGGRSCGPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLAANPDPKKLLKYLKKLSTLPITVDILAE TGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKV SHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMYVDHYRSLEEDQEPIVSHQKPGKGHSNAFQDRLGASQERHLGEPHGKGVVSQNKEH KSSHKDKRPVDAKSDEKASVVSREKSHKALSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPEKAKLDKSKQGL DSFDTGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEETDMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTG KNLDSVQKLPKVNKTKSEKPAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAFSSPQEEEEAGFTGRRMNSKMQVYSGSKCAYL PKMMTLHQQCIRVLKNNIDSIFEVGGVPYSVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKEERPEEYESWREMYLRLQDAREQRLRVLT KNIQFAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKIKIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSYD PRKPTVKKIAPMMAKTIKAFKNRFSRR*
Price: £125.00
Completion Time: 
17
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
PMID: 
rouse-CDKL5-paper-3

Human TNKS1BP1

DU Number: 
DU66234
Plasmid: 
pcDNA FRT TO 3FLAG TNKS1BP1 1-923+KKKV*
Expressed: 
3FLAG TNKS1BP1 1-923+KKKV*
Genbank: 
NM_033396.3
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
CTCGACATGAAAGTGTCTACTCTCAGGGAAAGCTCAGCCATGGCTTCCCCACTGCCCCGGGAGATGGAGGAGGAGCTGGTGCCTACTGGCTCTGAGCCAGGTGACACTCGGGCCAAACCCCCTGTCAAGCCCAAACCCCGGGCCCTGCCTGCCAAGCCAGCCCTGCCTGCCAAACCCAGCCTGCTGGTGCCTGTTGGGCCTCGGCCTCCCCGGGGTCCCCTGGCTGAGTTGCCTTCTGCCAGGAAGATGAACATGCTGGCAGGACCCCAGCCCTATGGTGGCAGCAAGCGCCCCCTTCCCTTTGCACCAAGGCCTGCGGTTGAGGCCTCCACTGGAGGAGAAGCCACCCAAGAGACTGGGAAAGAGGAGGCTGGGAAAGAGGAGCCACCCCCTTTGACACCCCCAGCTCGATGTGCAGCCCCAGGGGGTGTACGGAAGGCCCCTGCCCCTTTCCGCCCAGCCTCAGAGCGCTTCGCGGCCACCACGGTGGAAGAGATCCTGGCCAAGATGGAGCAGCCTCGGAAGGAGGTCCTTGCCAGCCCCGACCGCCTGTGGGGTTCCCGCCTCACCTTTAACCACGATGGCAGCTCGCGATATGGCCCCAGGACCTATGGCACGACCACTGCTCCCAGGGATGAGGATGGCAGCACCCTCTTCAGGGGATGGTCCCAGGAGGGGCCAGTAAAGTCTCCAGCAGAGTGCCGGGAAGAGCACAGCAAGACCCCTGAGGAGAGGAGCCTTCCTTCCGACCTGGCCTTCAACGGGGACCTGGCTAAGGCAGCCAGCTCGGAGCTACCTGCTGATATTTCCAAGCCCTGGATTCCCTCAAGTCCAGCCCCCTCCTCAGAGAATGGAGGCCCTGCCAGCCCAGGCCTCCCCGCAGAAGCCTCAGGCTCAGGCCCTGGCTCTCCCCATCTTCACCCGCCTGATAAGAGTTCTCCCTGCCACTCACAGCTTCTGGAAGCCCAGACTCCTGAAGCTTCCCAGGCTTCTCCCTGCCCCGCTGTGACTCCATCAGCTCGAAGTGCAGCCCTGCCTGACGAGGGCTCCCGCCACACCCCCAGCCCGGGGCTCCCTGCCGAGGGGGCTCCAGAGGCCCCCAGACCCAGCAGCCCACCCCCTGAGGTCTTGGAGCCCCATAGCCTGGATCAGCCCCCTGCCACCTCACCCCGGCCCCTGATCGAGGTGGGTGAGTTGCTGGATCTCACTCGGACGTTTCCATCTGGCGGGGAGGAGGAGGCCAAGGGTGACGCACACCTCCGCCCCACCAGCCTGGTTCAGCGCCGATTCTCTGAAGGTGTGCTCCAGTCACCCAGTCAGGACCAGGAGAAGCTGGGGGGCTCGCTGGCTGCCCTGCCCCAAGGCCAGGGGAGCCAGTTGGCCCTGGATCGTCCCTTTGGGGCAGAGTCCAACTGGAGCTTATCACAGTCCTTCGAATGGACCTTCCCCACGAGGCCCTCGGGTCTGGGCGTGTGGCGGCTGGACTCCCCGCCTCCCTCCCCCATCACTGAAGCCAGTGAGGCCGCCGAGGCTGCTGAGGCTGGCAACTTGGCCGTTTCCAGCAGGGAAGAAGGAGTGTCTCAGCAGGGGCAAGGGGCTGGGTCAGCTCCAAGTGGGTCAGGAAGTTCCTGGGTGCAGGGGGATGATCCAAGCATGTCCCTCACCCAGAAGGGCGATGGGGAGAGTCAACCTCAATTCCCAGCTGTTCCCCTTGAGCCCCTGCCTACAACTGAGGGCACACCTGGATTACCTTTGCAGCAGGCAGAGGAGAGATACGAGTCGCAGGAGCCCTTGGCTGGACAGGAGTCCCCTCTCCCCCTGGCTACCAGGGAGGCAGCCTTGCCCATCCTGGAGCCAGTCCTGGGGCAGGAGCAGCCAGCAGCCCCTGACCAGCCCTGTGTTCTCTTTGCTGATGCCCCTGAGCCTGGACAGGCACTGCCTGTTGAGGAGGAGGCCGTGACCCTAGCCCGGGCTGAGACCACCCAAGCCAGGACAGAGGCTCAAGACTTGTGTAGGGCATCCCCCGAGCCTCCAGGCCCTGAAAGCAGCTCCCGCTGGCTGGACGACCTCCTGGCTTCACCACCACCCAGTGGTGGCGGTGCAAGGCGGGGAGCTGGAGCTGAGCTGAAGGACACACAGTCCCCAAGTACCTGCTCTGAGGGACTCCTTGGCTGGTCCCAGAAAGATCTGCAGAGTGAATTTGGGATCACAGGAGACCCACAGCCCAGCAGTTTCAGTCCTTCCAGCTGGTGTCAAGGTGCTTCTCAGGACTATGGCCTTGGGGGTGCAAGCCCTAGAGGAGACCCAGGTCTCGGAGAGAGGGACTGGACCAGCAAGTATGGGCAAGGAGCAGGGGAAGGGAGCACCAGGGAGTGGGCCAGCAGGTGTGGCATCGGCCAGGAGGAGATGGAGGCCAGCAGCAGCCAAGACCAGAGTAAAGTGTCTGCCCCAGGGGTGCTCACAGCCCAGGACCGGGTAGTTGGAAAGCCAGCCCAGCTTGGCACTCAGCGGAGCCAGGAGGCAGATGTTCAGGACTGGGAGTTCAGAAAGAGGGATTCCCAGGGCACTTACTCCAGCCGGGATGCAGAACTCCAGGACCAGGAATTCGGAAAGAGAGATTCACTGGGTACCTACAGTAGTCGAGATGTAAGCCTTGGGGACTGGGAATTTGGGAAGAGAGATTCTCTGGGTGCTTATGCCAGCCAAGATGCCAACGAGCAGGGCCAAGATTTGGGGAAGAGGGACCACCATGGTAGGTACAGCAGCCAGGATGCCGATGAGCAGGACTGGGAGTTTCAGAAGAAGAAGAAGGTCTGAGCGGCCGCG
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSPEFPGRLDMKVSTLRESSAMASPLPREMEEELVPTGSEPGDTRAKPPVKPKPRALPAKPALPAKPSLLVPVGPRPPRGPLAELPSARKMNMLAGPQPYGGSKRPLPFAPRPAVEASTGGEATQETGKEEAGKEEPPPLTPPARCAAPGGVRKAPAPFRPASERFAATTVEEILAKMEQPRKEVLASPDRLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLFRGWSQEGPVKSPAECREEHSKTPEERSLPSDLAFNGDLAKAASSELPADISKPWIPSSPAPSSENGGPASPGLPAEASGSGPGSPHLHPPDKSSPCHSQLLEAQTPEASQASPCPAVTPSARSAALPDEGSRHTPSPGLPAEGAPEAPRPSSPPPEVLEPHSLDQPPATSPRPLIEVGELLDLTRTFPSGGEEEAKGDAHLRPTSLVQRRFSEGVLQSPSQDQEKLGGSLAALPQGQGSQLALDRPFGAESNWSLSQSFEWTFPTRPSGLGVWRLDSPPPSPITEASEAAEAAEAGNLAVSSREEGVSQQGQGAGSAPSGSGSSWVQGDDPSMSLTQKGDGESQPQFPAVPLEPLPTTEGTPGLPLQQAEERYESQEPLAGQESPLPLATREAALPILEPVLGQEQPAAPDQPCVLFADAPEPGQALPVEEEAVTLARAETTQARTEAQDLCRASPEPPGPESSSRWLDDLLASPPPSGGGARRGAGAELKDTQSPSTCSEGLLGWSQKDLQSEFGITGDPQPSSFSPSSWCQGASQDYGLGGASPRGDPGLGERDWTSKYGQGAGEGSTREWASRCGIGQEEMEASSSQDQSKVSAPGVLTAQDRVVGKPAQLGTQRSQEADVQDWEFRKRDSQGTYSSRDAELQDQEFGKRDSLGTYSSRDVSLGDWEFGKRDSLGAYASQDANEQGQDLGKRDHHGRYSSQDADEQDWEFQKKKKV*
Price: £125.00
Completion Time: 
46
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Restricted Distribution: 
Not Restricted

Human NEK11

DU Number: 
DU66237
Plasmid: 
pcDNA FRT TO NEK11 tv4 (Long) 3FLAG
Expressed: 
NEK11 tv4 (Long) 3FLAG
Genbank: 
NM_001321220.1
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGCTGAAATTCCAAGAGGCAGCTAAGTGTGTGAGTGGATCAACAGCCATTTCCACTTATCCAAAGACCTTGATTGCAAGAAGATACGTGCTTCAACAAAAACTTGGCAGTGGAAGTTTTGGAACTGTCTATCTGGTTTCAGACAAGAAAGCCAAACGAGGAGAGGAATTAAAGGTACTTAAGGAAATATCTGTTGGAGAACTAAATCCAAATGAAACTGTACAGGCCAATTTGGAAGCCCAACTCCTCTCCAAGCTGGACCACCCAGCCATTGTCAAGTTCCATGCAAGTTTTGTGGAGCAAGATAATTTCTGCATTATCACGGAGTACTGTGAGGGCCGAGATCTGGACGATAAAATTCAGGAATATAAACAAGCTGGAAAAATCTTTCCAGAAAATCAAATAATAGAATGGTTTATCCAGCTGCTGCTGGGAGTTGACTACATGCATGAGAGGAGGATACTTCATCGAGACTTAAAGTCAAAGAATGTATTTCTGAAAAATAATCTCCTTAAAATTGGAGATTTTGGAGTTTCTCGACTTCTAATGGGATCCTGTGACCTGGCCACAACTTTAACTGGAACTCCCCATTATATGAGTCCTGAGGCTCTGAAACACCAAGGCTATGACACAAAGTCGGACATCTGGTCACTGGCATGCATTTTGTATGAGATGTGCTGCATGAATCATGCATTCGCTGGCTCCAATTTCTTATCCATTGTTTTAAAAATTGTTGAAGGTGACACACCTTCTCTCCCTGAGAGATATCCAAAAGAACTAAATGCCATCATGGAAAGCATGTTGAACAAGAATCCTTCATTAAGACCATCTGCTATCGAAATTTTAAAAATCCCTTACCTTGATGAGCAGCTACAGAACCTAATGTGTAGATATTCAGAAATGACTCTGGAAGACAAAAATTTGGATTGTCAGAAGGAGGCTGCTCATATAATTAATGCCATGCAAAAAAGGATCCACCTGCAGACTCTGAGGGCACTGTCAGAAGTACAGAAAATGACGCCAAGAGAAAGGATGCGGCTGAGGAAGCTCCAGGCGGCTGATGAGAAAGCCAGGAAGCTGAAAAAGATTGTGGAAGAAAAATATGAAGAAAATAGCAAACGAATGCAAGAATTGAGATCTCGGAACTTTCAGCAGCTGAGTGTTGATGTACTCCATGAAAAAACACATTTAAAAGGAATGGAAGAAAAGGAGGAGCAACCTGAGGGAAGACTTTCTTGTTCACCCCAGGACGAGGATGAAGAGAGGTGGCAAGGCAGGGAAGAGGAATCTGATGAACCAACTTTAGAGAACCTGCCTGAGTCTCAGCCTATTCCTTCCATGGACCTCCACGAACTTGAATCAATTGTAGAGGATGCCACATCTGACCTTGGATACCATGAGATCCCAGAAGACCCACTTGTGGCTGAAGAGTACTACGCTGATGCATTTGATTCCTATTGTGAAGAGAGTGATGAGGAGGAAGAAGAAATAGCGTTAGAAAGACCAGAGAAAGAAATCAGGAATGAGGGATCCCAGCCTGCTTACAGAACAAACCAACAGGACAGTGATATCGAAGCGTTGGCCAGGTGTTTGGAAAATGTCCTGGGTTGCACTTCTCTAGACACAAAGACCATCACCACCATGGCTGAAGACATGTCCCCAGGACCACCAATTTTCAACAGTGTGATGGCCAGGACCAAGATGAAACGCATGAGGGAATCAGCCATGCAGAAGCTGGGGACAGAAGTATTTGAAGAGGTCTATAATTACCTCAAGAGAGCAAGGCATCAGAATGCTAGCGAAGCAGAGATCCGCGAGTGTTTGGAAAAAGTGGTGCCTCAAGCCAGCGACTGTTTTGAAGTGGACCAGCTCCTGTACTTTGAAGAGCAGTTGCTGATCACGATGGGAAAAGAACCTACTCTCCAGAACCATCTCGCGGCCGC
Amino Acid Sequence: 
MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDEERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYADAFDSYCEESDEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMSPGPPIFNSVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNASEAEIRECLEKVVPQASDCFEVDQLLYFEEQLLITMGKEPTLQNHLAAADYKDDDDKDYKDDDDKDYKDDDD*
Price: £125.00
Completion Time: 
57
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Restricted Distribution: 
Not Restricted

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.