3FLAG

CDKL5

cDNA Synonyms: 
EIEE2; ISSX; STK9
DU Number: 
DU67301
Plasmid: 
pBabeD blast CDKL5 K42R siRNA-res 3FLAG 2HA
Expressed: 
CDKL5 K42R siRNA-res 3FLAG 2HA
Genbank: 
NM_003159.2 with two silent changes
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGAGTTGTACTTAAATGCAGACACAAGGAAACACATGAAATTGTGGCGATCcgGAAATTCAAGGACAGTGAAGAAAATGAAGAAGTCAAAGAAACGACTTTACGAGAGCTTAAAATGCTTCGGACTCTCAAGCAGGAAAACATTGTGGAGTTGAAGGAAGCATTTCGTCGGAGGGGAAAGTTGTACTTGGTGTTTGAGTATGTTGAAAAAAATATGCTCGAATTGCTGGAAGAAATGCCAAATGGAGTTCCACCTGAGAAAGTAAAAAGCTACATCTATCAGCTAATCAAGGCTATTCACTGGTGCCATAAGAATGATATTGTCCATCGAGATATAAAACCAGAAAATCTCTTAATCAGCCACAATGATGTCCTAAAACTGTGTGACTTTGGTTTTGCTCGTAATCTGTCAGAAGGCAATAATGCTAATTACACAGAGTACGTTGCCACCAGATGGTATCGGTCCCCAGAACTCTTACTTGGCGCTCCCTATGGAAAGTCCGTGGACATGTGGTCGGTGGGCTGTATTCTTGGGGAGCTTAGCGATGGACAGCCTTTATTTCCTGGAGAAAGTGAAATTGACCAACTTTTTACTATTCAGAAGGTGCTAGGACCACTTCCATCTGAGCAGATGAAGCTTTTCTACAGTAATCCTCGCTTCCATGGGCTCCGGTTTCCAGCTGTTAACCATCCTCAGTCCTTGGAAAGAAGATACCTTGGAATTTTGAATAGTGTTCTACTTGACCTAATGAAGAATTTACTGAAGTTGGACCCtGCTGAtAGATACTTGACAGAACAGTGTTTGAATCACCCTACATTTCAAACCCAGAGACTTCTGGATCGTTCTCCTTCAAGGTCAGCAAAAAGAAAACCTTACCATGTGGAAAGCAGCACATTGTCTAATAGAAACCAAGCCGGCAAAAGCACTGCTTTGCAGTCTCACCACAGATCTAACAGCAAGGACATCCAGAACCTGAGTGTAGGCCTGCCCCGGGCTGACGAAGGTCTCCCTGCCAATGAAAGCTTCCTAAATGGAAACCTTGCTGGAGCTAGTCTTAGTCCACTGCACACCAAAACCTACCAAGCAAGCAGCCAGCCTGGGTCTACCAGCAAAGATCTCACCAACAACAACATACCACACCTTCTTAGCCCAAAAGAAGCCAAGTCAAAAACAGAGTTTGATTTTAATATTGACCCAAAGCCTTCAGAAGGCCCAGGGACAAAGTACCTCAAGTCAAACAGCAGATCTCAGCAGAACCGCCACTCATTCATGGAAAGCTCTCAAAGCAAAGCTGGGACACTGCAGCCCAATGAAAAGCAGAGTCGGCATAGCTATATTGACACAATTCCCCAGTCCTCTAGGAGTCCCTCCTACAGGACCAAGGCCAAAAGCCATGGGGCACTGAGTGACTCCAAGTCTGTGAGCAACCTTTCTGAAGCCAGGGCCCAAATTGCGGAGCCCAGTACCAGTAGGTACTTCCCATCTAGCTGCTTAGACTTGAATTCTCCCACCAGCCCAACCCCCACCAGACACAGTGACACGAGAACTTTGCTCAGCCCTTCTGGAAGAAATAACCGAAATGAGGGAACGCTGGACTCACGTCGAACCACAACCAGACATTCTAAGACGATGGAGGAATTGAAGCTGCCGGAGCACATGGACAGTAGCCATTCCCATTCACTGTCTGCACCTCACGAATCTTTTTCTTATGGACTGGGCTACACCAGCCCCTTTTCTTCCCAGCAACGTCCTCATAGGCATTCTATGTATGTGACCCGTGACAAAGTGAGAGCCAAGGGCTTGGATGGAAGCTTGAGCATAGGGCAAGGGATGGCAGCTAGAGCCAACAGCCTGCAACTCTTGTCACCCCAGCCTGGAGAACAGCTCCCTCCAGAGATGACTGTGGCAAGATCTTCGGTCAAAGAGACCTCCAGAGAAGGCACCTCTTCCTTCCATACACGCCAGAAGTCTGAGGGTGGAGTGTATCATGACCCACACTCTGATGATGGCACAGCCCCCAAAGAAAATAGACACCTATACAATGACCCTGTGCCAAGGAGAGTTGGTAGCTTTTACAGAGTGCCATCTCCACGTCCAGACAATTCTTTCCATGAAAATAATGTGTCAACTAGAGTTTCTTCTCTACCATCAGAGAGCAGTTCTGGAACCAACCACTCAAAAAGACAACCAGCATTCGATCCATGGAAAAGTCCTGAAAATATTAGTCATTCAGAGCAACTCAAGGAAAAAGAGAAGCAAGGATTTTTCAGGTCAATGAAAAAGAAAAAGAAGAAATCTCAAACAGTACCCAATTCCGACAGCCCTGATCTTCTGACGTTGCAGAAATCCATTCATTCTGCTAGCACTCCAAGCAGCAGACCAAAGGAGTGGCGCCCCGAGAAGATCTCAGATCTGCAGACCCAAAGCCAGCCATTAAAATCACTGCGCAAGTTGTTACATCTCTCTTCGGCCTCAAATCACCCGGCTTCCTCAGATCCCCGCTTCCAGCCCTTAACAGCTCAACAAACCAAAAATTCCTTCTCAGAAATTCGGATTCACCCCCTGAGCCAGGCCTCTGGCGGGAGCAGCAACATCCGGCAGGAACCCGCACCGAAGGGCAGGCCAGCCCTCCAGCTGCCAGACGGTGGATGTGATGGCAGAAGACAGAGACACCATTCTGGACCCCAAGATAGACGCTTCATGTTAAGGACGACAGAACAACAAGGAGAATACTTCTGCTGTGGTGACCCAAAGAAGCCTCACACTCCGTGCGTCCCAAACCGAGCCCTTCATCGTCCAATCTCCAGTCCTGCTCCCTATCCAGTACTCCAGGTCCGAGGCACTTCCATGTGCCCGACACTCCAGGTCCGAGGCACTGATGCTTTCAGCTGCCCAACCCAGCAATCCGGGTTCTCTTTCTTCGTGAGACACGTTATGAGGGAAGCCCTGATTCACAGGGCCCAGGTAAACCAAGCTGCGCTCCTGACATACCATGAGAATGCGGCACTGACGGGCAAGgcggccgc
Amino Acid Sequence: 
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIRKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLE LLEEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEYVATRWYRSPELLLGAPYGKSVDMWSVG CILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQ TQRLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHRSNSKDIQNLSVGLPRADEGLPANESFLNGNLAGASLSPLHTKTYQASSQPGSTSKDLT NNNIPHLLSPKEAKSKTEFDFNIDPKPSEGPGTKYLKSNSRSQQNRHSFMESSQSKAGTLQPNEKQSRHSYIDTIPQSSRSPSYRTKAKSHGALSDSKSV SNLSEARAQIAEPSTSRYFPSSCLDLNSPTSPTPTRHSDTRTLLSPSGRNNRNEGTLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGY TSPFSSQQRPHRHSMYVTRDKVRAKGLDGSLSIGQGMAARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPK ENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDS PDLLTLQKSIHSASTPSSRPKEWRPEKISDLQTQSQPLKSLRKLLHLSSASNHPASSDPRFQPLTAQQTKNSFSEIRIHPLSQASGGSSNIRQEPAPKGR PALQLPDGGCDGRRQRHHSGPQDRRFMLRTTEQQGEYFCCGDPKKPHTPCVPNRALHRPISSPAPYPVLQVRGTSMCPTLQVRGTDAFSCPTQQSGFSFF VRHVMREALIHRAQVNQAALLTYHENAALTGKAAADYKDHDGDYKDHDIDYKDDDDKYPYDVPDYAYPYDVPDYA*
Price: £125.00
Completion Time: 
10
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
PMID: 
rouse-CDKL5-paper-3

CDKL5

cDNA Synonyms: 
EIEE2; ISSX; STK9
DU Number: 
DU67300
Plasmid: 
pBabeD blast CDKL5 siRNA-res 3FLAG 2HA
Expressed: 
CDKL5 siRNA-res 3FLAG 2HA
Genbank: 
NM_003159.2 with two silent changes
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGAGTTGTACTTAAATGCAGACACAAGGAAACACATGAAATTGTGGCGATCAAGAAATTCAAGGACAGTGAAGAAAATGAAGAAGTCAAAGAAACGACTTTACGAGAGCTTAAAATGCTTCGGACTCTCAAGCAGGAAAACATTGTGGAGTTGAAGGAAGCATTTCGTCGGAGGGGAAAGTTGTACTTGGTGTTTGAGTATGTTGAAAAAAATATGCTCGAATTGCTGGAAGAAATGCCAAATGGAGTTCCACCTGAGAAAGTAAAAAGCTACATCTATCAGCTAATCAAGGCTATTCACTGGTGCCATAAGAATGATATTGTCCATCGAGATATAAAACCAGAAAATCTCTTAATCAGCCACAATGATGTCCTAAAACTGTGTGACTTTGGTTTTGCTCGTAATCTGTCAGAAGGCAATAATGCTAATTACACAGAGTACGTTGCCACCAGATGGTATCGGTCCCCAGAACTCTTACTTGGCGCTCCCTATGGAAAGTCCGTGGACATGTGGTCGGTGGGCTGTATTCTTGGGGAGCTTAGCGATGGACAGCCTTTATTTCCTGGAGAAAGTGAAATTGACCAACTTTTTACTATTCAGAAGGTGCTAGGACCACTTCCATCTGAGCAGATGAAGCTTTTCTACAGTAATCCTCGCTTCCATGGGCTCCGGTTTCCAGCTGTTAACCATCCTCAGTCCTTGGAAAGAAGATACCTTGGAATTTTGAATAGTGTTCTACTTGACCTAATGAAGAATTTACTGAAGTTGGACCCtGCTGAtAGATACTTGACAGAACAGTGTTTGAATCACCCTACATTTCAAACCCAGAGACTTCTGGATCGTTCTCCTTCAAGGTCAGCAAAAAGAAAACCTTACCATGTGGAAAGCAGCACATTGTCTAATAGAAACCAAGCCGGCAAAAGCACTGCTTTGCAGTCTCACCACAGATCTAACAGCAAGGACATCCAGAACCTGAGTGTAGGCCTGCCCCGGGCTGACGAAGGTCTCCCTGCCAATGAAAGCTTCCTAAATGGAAACCTTGCTGGAGCTAGTCTTAGTCCACTGCACACCAAAACCTACCAAGCAAGCAGCCAGCCTGGGTCTACCAGCAAAGATCTCACCAACAACAACATACCACACCTTCTTAGCCCAAAAGAAGCCAAGTCAAAAACAGAGTTTGATTTTAATATTGACCCAAAGCCTTCAGAAGGCCCAGGGACAAAGTACCTCAAGTCAAACAGCAGATCTCAGCAGAACCGCCACTCATTCATGGAAAGCTCTCAAAGCAAAGCTGGGACACTGCAGCCCAATGAAAAGCAGAGTCGGCATAGCTATATTGACACAATTCCCCAGTCCTCTAGGAGTCCCTCCTACAGGACCAAGGCCAAAAGCCATGGGGCACTGAGTGACTCCAAGTCTGTGAGCAACCTTTCTGAAGCCAGGGCCCAAATTGCGGAGCCCAGTACCAGTAGGTACTTCCCATCTAGCTGCTTAGACTTGAATTCTCCCACCAGCCCAACCCCCACCAGACACAGTGACACGAGAACTTTGCTCAGCCCTTCTGGAAGAAATAACCGAAATGAGGGAACGCTGGACTCACGTCGAACCACAACCAGACATTCTAAGACGATGGAGGAATTGAAGCTGCCGGAGCACATGGACAGTAGCCATTCCCATTCACTGTCTGCACCTCACGAATCTTTTTCTTATGGACTGGGCTACACCAGCCCCTTTTCTTCCCAGCAACGTCCTCATAGGCATTCTATGTATGTGACCCGTGACAAAGTGAGAGCCAAGGGCTTGGATGGAAGCTTGAGCATAGGGCAAGGGATGGCAGCTAGAGCCAACAGCCTGCAACTCTTGTCACCCCAGCCTGGAGAACAGCTCCCTCCAGAGATGACTGTGGCAAGATCTTCGGTCAAAGAGACCTCCAGAGAAGGCACCTCTTCCTTCCATACACGCCAGAAGTCTGAGGGTGGAGTGTATCATGACCCACACTCTGATGATGGCACAGCCCCCAAAGAAAATAGACACCTATACAATGACCCTGTGCCAAGGAGAGTTGGTAGCTTTTACAGAGTGCCATCTCCACGTCCAGACAATTCTTTCCATGAAAATAATGTGTCAACTAGAGTTTCTTCTCTACCATCAGAGAGCAGTTCTGGAACCAACCACTCAAAAAGACAACCAGCATTCGATCCATGGAAAAGTCCTGAAAATATTAGTCATTCAGAGCAACTCAAGGAAAAAGAGAAGCAAGGATTTTTCAGGTCAATGAAAAAGAAAAAGAAGAAATCTCAAACAGTACCCAATTCCGACAGCCCTGATCTTCTGACGTTGCAGAAATCCATTCATTCTGCTAGCACTCCAAGCAGCAGACCAAAGGAGTGGCGCCCCGAGAAGATCTCAGATCTGCAGACCCAAAGCCAGCCATTAAAATCACTGCGCAAGTTGTTACATCTCTCTTCGGCCTCAAATCACCCGGCTTCCTCAGATCCCCGCTTCCAGCCCTTAACAGCTCAACAAACCAAAAATTCCTTCTCAGAAATTCGGATTCACCCCCTGAGCCAGGCCTCTGGCGGGAGCAGCAACATCCGGCAGGAACCCGCACCGAAGGGCAGGCCAGCCCTCCAGCTGCCAGACGGTGGATGTGATGGCAGAAGACAGAGACACCATTCTGGACCCCAAGATAGACGCTTCATGTTAAGGACGACAGAACAACAAGGAGAATACTTCTGCTGTGGTGACCCAAAGAAGCCTCACACTCCGTGCGTCCCAAACCGAGCCCTTCATCGTCCAATCTCCAGTCCTGCTCCCTATCCAGTACTCCAGGTCCGAGGCACTTCCATGTGCCCGACACTCCAGGTCCGAGGCACTGATGCTTTCAGCTGCCCAACCCAGCAATCCGGGTTCTCTTTCTTCGTGAGACACGTTATGAGGGAAGCCCTGATTCACAGGGCCCAGGTAAACCAAGCTGCGCTCCTGACATACCATGAGAATGCGGCACTGACGGGCAAGgcggccgc
Amino Acid Sequence: 
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELL EEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEYVATRWYRSPELLLGAPYGKSVDMWSVGCI LGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQ RLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHRSNSKDIQNLSVGLPRADEGLPANESFLNGNLAGASLSPLHTKTYQASSQPGSTSKDLTNN NIPHLLSPKEAKSKTEFDFNIDPKPSEGPGTKYLKSNSRSQQNRHSFMESSQSKAGTLQPNEKQSRHSYIDTIPQSSRSPSYRTKAKSHGALSDSKSVSN LSEARAQIAEPSTSRYFPSSCLDLNSPTSPTPTRHSDTRTLLSPSGRNNRNEGTLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGYTS PFSSQQRPHRHSMYVTRDKVRAKGLDGSLSIGQGMAARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKEN RHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPD LLTLQKSIHSASTPSSRPKEWRPEKISDLQTQSQPLKSLRKLLHLSSASNHPASSDPRFQPLTAQQTKNSFSEIRIHPLSQASGGSSNIRQEPAPKGRPA LQLPDGGCDGRRQRHHSGPQDRRFMLRTTEQQGEYFCCGDPKKPHTPCVPNRALHRPISSPAPYPVLQVRGTSMCPTLQVRGTDAFSCPTQQSGFSFFVR HVMREALIHRAQVNQAALLTYHENAALTGKAAADYKDHDGDYKDHDIDYKDDDDKYPYDVPDYAYPYDVPDYA*
Price: £125.00
Completion Time: 
10
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
PMID: 
rouse-CDKL5-paper-3

Vector

DU Number: 
DU67277
Plasmid: 
pBabeD blast C-3FLAG 2HA
Genbank: 
NA
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
See attached snapgene file
Amino Acid Sequence: 
See attached snapgene file
Price: £125.00
Completion Time: 
7
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
PMID: 
rouse-CDKL5-paper-3
COVID-19: 
No
Ubiquitylation Site: 
No

WDR5

cDNA Synonyms: 
BIG-3; CFAP89; SWD3
DU Number: 
DU67266
Plasmid: 
pcDNA5 FRT/TO 3FLAG WDR5
Expressed: 
3FLAG WDR5
Genbank: 
NM_017588.2 with one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCGCCATGGCGACGGAGGAGAAGAAGCCTGAGACCGAGGCCGCCAGAGCACAGCCAACCCCTTCGTCATCCGCCACTCAGAGCAAGCCTACACCTGTGAAGCCAAACTATGCTCTAAAGTTCACCCTTGCTGGCCACACCAAAGCAGTGTCCTCCGTGAAATTCAGCCCGAATGGAGAGTGGCTGGCAAGTTCATCTGCTGATAAACTTATTAAAATTTGGGGCGCGTATGATGGGAAATTTGAGAAAACCATATCTGGTCACAAGCTGGGAATATCCGATGTAGCCTGGTCGTCAGATTCTAACCTTCTTGTTTCTGCCTCAGATGACAAAACCTTGAAGATATGGGACGTGAGCTCGGGCAAGTGTCTGAAAACCCTGAAGGGACACAGTAATTATGTCTTTTGCTGCAACTTCAATCCCCAGTCCAACCTTATTGTCTCAGGATCCTTTGACGAAAGCGTGAGGATATGGGATGTGAAAACAGGGAAGTGCCTCAAGACTTTGCCAGCTCACTCGGATCCAGTCTCGGCCGTTCATTTTAATCGTGATGGATCCTTGATAGTTTCAAGTAGCTATGATGGTCTCTGTCGCATCTGGGACACCGCCTCAGGCCAGTGCCTGAAGACGCTCATCGATGACGACAACCCCCCCGTGTCTTTTGTGAAGTTCTCCCCGAACGGCAAATACATCCTGGCCGCCACGCTGGACAACACTCTGAAGCTCTGGGACTACAGCAAGGGGAAGTGCCTGAAGACGTACACTGGCCACAAGAATGAGAAATACTGCATATTTGCCAATTTCTCTGTTACTGGTGGGAAGTGGATTGTGTCTGGCTCAGAGGATAACCTTGTTTACATCTGGAACCTTCAGACGAAAGAGATTGTACAGAAACTACAAGGCCACACAGATGTCGTGATCTCAACAGCTTGTCACCCAACAGAAAACATCATCGCCTCTGCTGCGCTAGAAAATGACAAAACAATTAAACTGTGGAAGAGTGACTGCTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSPEFAMATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADK LIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL PAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFS VTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC*
Price: £125.00
Completion Time: 
6
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

DDB2

cDNA Synonyms: 
FLJ34321
DU Number: 
DU67265
Plasmid: 
pcDNA5 FRT/TO 3FLAG DDB2
Expressed: 
3FLAG DDB2
Genbank: 
NM_000107.1 with one silent change
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTCCCAAGAAACGCCCAGAAACCCAGAAGACCTCCGAGATTGTATTACGCCCCAGGAACAAGAGGAGCAGGAGTCCCCTGGAGCTGGAGCCCGAGGCCAAGAAGCTCTGTGCGAAGGGCTCCGGTCCTAGCAGAAGATGTGACTCAGACTGCCTCTGGGTGGGGCTGGCTGGCCCACAGATCCTGCCACCATGCCGCAGCATCGTCAGGACCCTCCACCAGCATAAGCTGGGCAGAGCTTCCTGGCCATCTGTCCAGCAGGGGCTCCAGCAGTCCTTTTTGCACACTCTGGATTCTTACCGGATATTACAAAAGGCTGCCCCCTTTGACAGGAGGGCTACATCCTTGGCGTGGCACCCAACTCACCCCAGCACCGTGGCTGTGGGTTCCAAAGGGGGAGATATCATGCTCTGGAATTTTGGCATCAAGGACAAACCCACCTTCATCAAAGGGATTGGAGCTGGAGGGAGCATCACTGGGCTGAAGTTTAACCCTCTCAATACCAACCAGTTTTACGCCTCCTCAATGGAGGGAACAACTAGGCTGCAAGACTTTAAAGGCAACATTCTACGAGTTTTTGCCAGCTCAGACACCATCAACATCTGGTTTTGTAGCCTGGATGTGTCTGCTAGTAGCCGAATGGTGGTCACAGGAGACAACGTGGGGAACGTGATCCTGCTGAACATGGACGGCAAAGAGCTTTGGAATCTCAGAATGCACAAAAAGAAAGTGACGCATGTGGCCCTGAACCCATGCTGTGATTGGTTCCTGGCCACAGCCTCCGTAGATCAAACAGTGAAAATTTGGGACCTGCGCCAGGTTAGAGGGAAAGCCAGCTTCCTCTACTCGCTGCCGCACAGGCATCCTGTCAACGCAGCTTGTTTCAGTCCCGATGGAGCCCGGCTCCTGACCACGGACCAGAAGAGCGAGATCCGAGTTTACTCTGCTTCCCAGTGGGACTGCCCCCTGGGCCTGATCCCGCACCCTCACCGTCACTTCCAGCACCTCACACCTATCAAGGCAGCCTGGCATCCTCGCTACAACCTCATTGTTGTGGGCCGATACCCAGATCCTAATTTCAAAAGTTGTACCCCTTATGAATTGAGGACGATCGACGTGTTCGATGGAAACTCAGGGAAGATGATGTGTCAGCTCTATGACCCAGAATCTTCTGGCATCAGTTCGCTTAATGAATTCAATCCCATGGGGGACACGCTGGCCTCTGCAATGGGTTACCACATTCTCATCTGGAGCCAGGAGGAAGCCAGGACACGGAAGTGAGGATCC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIVR TLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQ FYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWD LRQVRGKASFLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPNFKSCTPYELRT IDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQEEARTRK*
Price: £125.00
Completion Time: 
6
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WDR76

cDNA Synonyms: 
CDW14
DU Number: 
DU67264
Plasmid: 
pcDNA5 FRT/TO 3FLAG WDR76
Expressed: 
3FLAG WDR76
Genbank: 
NM_024908.3 with residue change S153A (Natural variant,RNA-derived)
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
aGATCTATGTCCAGGTCGGGCGCGGCGGCTGAGAAGGCGGACTCCAGACAGCGACCCCAGATGAAGGTAAATGAATATAAAGAAAATCAAAACATCGCTTATGTGTCTCTGAGACCAGCACAGACTACAGTTTTAATAAAAACAGCTAAGGTCTATCTTGCCCCCTTTTCACTCAGTAATTACCAGCTAGACCAGCTTATGTGCCCCAAATCCCTATCAGAAAAGAATTCTAACAATGAAGTGGCGTGTAAGAAGACTAAAATAAAGAAAACTTGCAGAAGGATTATACCTCCAAAGATGAAAAACACATCTTCCAAGGCAGAATCCACGCTGCAAAATTCATCCTCAGCTGTTCATACTGAAAGTAACAAGCTACAACCCAAGAGAACGGCAGATGCGATGAATCTCAGTGTTGATGTGGAAAGTAGTCAGGATGGAGACAGTGATGAAGATACCACACCAGCCCTGGATTTTTCGGGATTGTCACCCTACGAAAGGAAGAGACTGAAGAACATATCAGAAAACGCAGACTTTTTTGCTTCTCTTCAGTTGTCTGAGTCTGCTGCAAGACTCCGTGAAATGATAGAGAAGAGACAGCCTCCTAAATCCAAAAGAAAGAAGCCTAAGAGAGAAAATGGGATTGGATGTAGAAGGTCAATGCGATTACTAAAAGTTGATCCTTCGGGAGTTTCATTACCAGCAGCTCCAACACCGCCGACATTAGTAGCAGATGAAACTCCTTTGTTACCTCCTGGGCCTTTAGAAATGACTTCTGAAAATCAAGAAGACAACAATGAACGATTTAAAGGATTTCTGCACACATGGGCAGGAATGAGCAAGCCAAGTAGTAAGAACACTGAGAAGGGATTATCTAGCATTAAAAGCTACAAAGCCAATTTAAATGGCATGGTCATTAGTGAAGATACCGTTTACAAAGTTACCACAGGCCCAATATTCTCTATGGCTCTCCATCCATCAGAAACTAGAACTTTGGTAGCAGTTGGGGCCAAATTTGGGCAAGTTGGACTTTGTGATTTGACCCAGCAACCTAAAGAAGATGGAGTTTATGTTTTTCATCCCCATAGTCAGCCAGTTAGCTGTCTTTACTTCTCACCCGCCAATCCGGCCCACATACTGTCACTGAGCTATGATGGCACGTTACGCTGTGGGGATTTTTCCAGGGCTATTTTTGAAGAGGTGTATAGAAATGAAAGAAGTAGCTTTTCCTCCTTCGACTTCTTGGCAGAAGATGCCTCCACTTTAATAGTAGGACACTGGGATGGAAATATGTCACTGGTGGATAGACGGACACCTGGAACTTCTTATGAGAAACTTACCAGTTCTTCTATGGGAAAAATAAGAACTGTTCATGTCCACCCAGTGCATAGACAGTATTTTATCACTGCCGGATTGAGGGATACTCATATTTATGATGCAAGGCGATTGAATTCCAGGAGAAGTCAGCCTTTGATTTCTTTGACTGAACATACAAAGAGCATTGCTTCCGCCTATTTTTCACCTCTTACTGGTAACAGAGTGGTGACCACATGTGCTGATTGTAATCTGAGAATTTTTGACAGCAGCTGTATATCTTCTAAGATTCCGCTCCTCACCACCATCAGGCACAACACTTTCACTGGGCGATGGCTGACCAGGTTCCAAGCCATGTGGGATCCTAAACAAGAAGACTGTGTCATAGTTGGCAGCATGGCCCATCCACGACGGGTAGAAATCTTCCATGAGACAGGAAAGAGGGTGCATTCGTTTGGTGGAGAATACCTTGTCTCTGTGTGTTCCATCAATGCCATGCACCCAACTCGGTATATTTTGGCTGGAGGTAATTCCAGCGGGAAGATACATGTTTTTATGAATGAAAAAAGCTGCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMSRSGAAAEKADSRQRPQMKVNEYKENQNIAYVSLRPAQTTVLIKTAKVYLAPFSLSNYQLDQLMCPKSLS EKNSNNEVACKKTKIKKTCRRIIPPKMKNTSSKAESTLQNSSSAVHTESNKLQPKRTADAMNLSVDVESSQDGDSDEDTTPALDFSGLSPYERKRLKNIS ENADFFASLQLSESAARLREMIEKRQPPKSKRKKPKRENGIGCRRSMRLLKVDPSGVSLPAAPTPPTLVADETPLLPPGPLEMTSENQEDNNERFKGFLH TWAGMSKPSSKNTEKGLSSIKSYKANLNGMVISEDTVYKVTTGPIFSMALHPSETRTLVAVGAKFGQVGLCDLTQQPKEDGVYVFHPHSQPVSCLYFSPA NPAHILSLSYDGTLRCGDFSRAIFEEVYRNERSSFSSFDFLAEDASTLIVGHWDGNMSLVDRRTPGTSYEKLTSSSMGKIRTVHVHPVHRQYFITAGLRD THIYDARRLNSRRSQPLISLTEHTKSIASAYFSPLTGNRVVTTCADCNLRIFDSSCISSKIPLLTTIRHNTFTGRWLTRFQAMWDPKQEDCVIVGSMAHP RRVEIFHETGKRVHSFGGEYLVSVCSINAMHPTRYILAGGNSSGKIHVFMNEKSC*
Price: £125.00
Completion Time: 
6
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WDR5B

DU Number: 
DU67262
Plasmid: 
pcDNA5 FRT/TO 3FLAG WDR5B
Expressed: 
3FLAG WDR5B
Genbank: 
NM_019069.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCAACCAAGGAGTCAAGAGACGCCAAAGCACAGTTGGCCCTCTCCTCATCGGCCAATCAGAGCAAGGAAGTGCCTGAAAACCCAAACTATGCTCTCAAATGTACTCTTGTGGGACACACGGAAGCAGTGTCATCAGTTAAGTTTAGTCCTAATGGAGAATGGCTAGCAAGTTCTTCTGCTGATAGGCTAATCATAATTTGGGGAGCATATGATGGAAAATATGAGAAAACACTCTATGGTCATAATTTGGAAATATCGGATGTTGCCTGGTCATCAGATTCCAGTCGTCTTGTTTCTGCCTCAGATGATAAAACTCTAAAATTATGGGATGTGAGATCTGGAAAATGTTTGAAAACACTGAAGGGGCACAGTAATTATGTCTTTTGTTGTAACTTCAATCCGCCATCCAACCTTATAATCTCGGGATCTTTTGATGAGACTGTAAAAATATGGGAGGTGAAAACAGGAAAGTGTCTCAAGACTTTGTCTGCTCATTCTGACCCAGTTTCTGCTGTTCATTTTAATTGTAGTGGGTCCTTGATAGTGTCAGGTAGCTATGATGGCCTCTGTAGAATCTGGGATGCTGCATCAGGTCAGTGTTTAAAAACGCTCGTTGATGACGATAACCCTCCTGTCTCTTTTGTAAAATTTTCTCCAAATGGTAAATACATTCTCACTGCAACTTTGGACAACACTCTTAAACTATGGGATTATAGCAGAGGCAGGTGCCTGAAAACATACACTGGTCATAAGAATGAGAAATATTGCATATTTGCCAATTTTTCAGTTACTGGTGGAAAGTGGATTGTGTCTGGTTCCGAGGATAACCTGGTTTACATTTGGAACCTTCAGACTAAAGAGATTGTGCAGAAATTACAAGGCCATACAGATGTTGTGATCTCAGCAGCTTGTCATCCTACAGAAAACCTCATCGCATCAGCAGCATTAGAAAATGACAAAACAATTAAACTGTGGATGAGTAACCACTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMATKESRDAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAY DGKYEKTLYGHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVS AVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIV SGSEDNLVYIWNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLWMSNH*
Price: £125.00
Completion Time: 
6
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

DDA1

cDNA Synonyms: 
C19orf58; PCIA1
DU Number: 
DU67267
Plasmid: 
pcDNA5 FRT/TO 3FLAG DDA1
Expressed: 
3FLAG DDA1
Genbank: 
NM_024050.5
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCAGATTTTTTGAAAGGACTGCCTGTCTACAACAAAAGCAATTTTAGTCGATTTCACGCGGACTCCGTGTGCAAAGCCTCGAACCGACGGCCCTCAGTCTACCTGCCTACCCGCGAGTACCCGTCTGAACAGATCATCGTGACAGAAAAGACAAACATCCTCCTGCGCTACCTGCATCAGCAATGGGACAAAAAGAACGCTGCCAAGAAGAGAGACCAGGAGCAAGTGGAGCTGGAAGGCGAGAGCTCCGCACCTCCCCGCAAGGTGGCGCGGACCGACAGCCCAGACATGCACGAGGACACTTAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKK RDQEQVELEGESSAPPRKVARTDSPDMHEDT*
Price: £125.00
Completion Time: 
6
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

NEK11

DU Number: 
DU66199
Plasmid: 
pcDNA FRT TO NEK11 tv4 (Long)
Expressed: 
NEK11 tv4 (Long)
Genbank: 
NM_001321220.1
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGCTGAAATTCCAAGAGGCAGCTAAGTGTGTGAGTGGATCAACAGCCATTTCCACTTATCCAAAGACCTTGATTGCAAGAAGATACGTGCTTCAACAAAAACTTGGCAGTGGAAGTTTTGGAACTGTCTATCTGGTTTCAGACAAGAAAGCCAAACGAGGAGAGGAATTAAAGGTACTTAAGGAAATATCTGTTGGAGAACTAAATCCAAATGAAACTGTACAGGCCAATTTGGAAGCCCAACTCCTCTCCAAGCTGGACCACCCAGCCATTGTCAAGTTCCATGCAAGTTTTGTGGAGCAAGATAATTTCTGCATTATCACGGAGTACTGTGAGGGCCGAGATCTGGACGATAAAATTCAGGAATATAAACAAGCTGGAAAAATCTTTCCAGAAAATCAAATAATAGAATGGTTTATCCAGCTGCTGCTGGGAGTTGACTACATGCATGAGAGGAGGATACTTCATCGAGACTTAAAGTCAAAGAATGTATTTCTGAAAAATAATCTCCTTAAAATTGGAGATTTTGGAGTTTCTCGACTTCTAATGGGATCCTGTGACCTGGCCACAACTTTAACTGGAACTCCCCATTATATGAGTCCTGAGGCTCTGAAACACCAAGGCTATGACACAAAGTCGGACATCTGGTCACTGGCATGCATTTTGTATGAGATGTGCTGCATGAATCATGCATTCGCTGGCTCCAATTTCTTATCCATTGTTTTAAAAATTGTTGAAGGTGACACACCTTCTCTCCCTGAGAGATATCCAAAAGAACTAAATGCCATCATGGAAAGCATGTTGAACAAGAATCCTTCATTAAGACCATCTGCTATCGAAATTTTAAAAATCCCTTACCTTGATGAGCAGCTACAGAACCTAATGTGTAGATATTCAGAAATGACTCTGGAAGACAAAAATTTGGATTGTCAGAAGGAGGCTGCTCATATAATTAATGCCATGCAAAAAAGGATCCACCTGCAGACTCTGAGGGCACTGTCAGAAGTACAGAAAATGACGCCAAGAGAAAGGATGCGGCTGAGGAAGCTCCAGGCGGCTGATGAGAAAGCCAGGAAGCTGAAAAAGATTGTGGAAGAAAAATATGAAGAAAATAGCAAACGAATGCAAGAATTGAGATCTCGGAACTTTCAGCAGCTGAGTGTTGATGTACTCCATGAAAAAACACATTTAAAAGGAATGGAAGAAAAGGAGGAGCAACCTGAGGGAAGACTTTCTTGTTCACCCCAGGACGAGGATGAAGAGAGGTGGCAAGGCAGGGAAGAGGAATCTGATGAACCAACTTTAGAGAACCTGCCTGAGTCTCAGCCTATTCCTTCCATGGACCTCCACGAACTTGAATCAATTGTAGAGGATGCCACATCTGACCTTGGATACCATGAGATCCCAGAAGACCCACTTGTGGCTGAAGAGTACTACGCTGATGCATTTGATTCCTATTGTGAAGAGAGTGATGAGGAGGAAGAAGAAATAGCGTTAGAAAGACCAGAGAAAGAAATCAGGAATGAGGGATCCCAGCCTGCTTACAGAACAAACCAACAGGACAGTGATATCGAAGCGTTGGCCAGGTGTTTGGAAAATGTCCTGGGTTGCACTTCTCTAGACACAAAGACCATCACCACCATGGCTGAAGACATGTCCCCAGGACCACCAATTTTCAACAGTGTGATGGCCAGGACCAAGATGAAACGCATGAGGGAATCAGCCATGCAGAAGCTGGGGACAGAAGTATTTGAAGAGGTCTATAATTACCTCAAGAGAGCAAGGCATCAGAATGCTAGCGAAGCAGAGATCCGCGAGTGTTTGGAAAAAGTGGTGCCTCAAGCCAGCGACTGTTTTGAAGTGGACCAGCTCCTGTACTTTGAAGAGCAGTTGCTGATCACGATGGGAAAAGAACCTACTCTCCAGAACCATCTCTAGGCGGCCGC
Amino Acid Sequence: 
MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDEERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYADAFDSYCEESDEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMSPGPPIFNSVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNASEAEIRECLEKVVPQASDCFEVDQLLYFEEQLLITMGKEPTLQNHL*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

NEK11

DU Number: 
DU66195
Plasmid: 
pcDNA FRT TO 3 FLAG NEK11 tv4 (Long) K61R D175A
Expressed: 
3FLAG NEK11 tv4 (Long) K61R D175A
Genbank: 
NM_001321220.1
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGCTGAAATTCCAAGAGGCAGCTAAGTGTGTGAGTGGATCAACAGCCATTTCCACTTATCCAAAGACCTTGATTGCAAGAAGATACGTGCTTCAACAAAAACTTGGCAGTGGAAGTTTTGGAACTGTCTATCTGGTTTCAGACAAGAAAGCCAAACGAGGAGAGGAATTAAAGGTACTTAGAGAAATATCTGTTGGAGAACTAAATCCAAATGAAACTGTACAGGCCAATTTGGAAGCCCAACTCCTCTCCAAGCTGGACCACCCAGCCATTGTCAAGTTCCATGCAAGTTTTGTGGAGCAAGATAATTTCTGCATTATCACGGAGTACTGTGAGGGCCGAGATCTGGACGATAAAATTCAGGAATATAAACAAGCTGGAAAAATCTTTCCAGAAAATCAAATAATAGAATGGTTTATCCAGCTGCTGCTGGGAGTTGACTACATGCATGAGAGGAGGATACTTCATCGAGACTTAAAGTCAAAGAATGTATTTCTGAAAAATAATCTCCTTAAAATTGGAGCCTTTGGAGTTTCTCGACTTCTAATGGGATCCTGTGACCTGGCCACAACTTTAACTGGAACTCCCCATTATATGAGTCCTGAGGCTCTGAAACACCAAGGCTATGACACAAAGTCGGACATCTGGTCACTGGCATGCATTTTGTATGAGATGTGCTGCATGAATCATGCATTCGCTGGCTCCAATTTCTTATCCATTGTTTTAAAAATTGTTGAAGGTGACACACCTTCTCTCCCTGAGAGATATCCAAAAGAACTAAATGCCATCATGGAAAGCATGTTGAACAAGAATCCTTCATTAAGACCATCTGCTATCGAAATTTTAAAAATCCCTTACCTTGATGAGCAGCTACAGAACCTAATGTGTAGATATTCAGAAATGACTCTGGAAGACAAAAATTTGGATTGTCAGAAGGAGGCTGCTCATATAATTAATGCCATGCAAAAAAGGATCCACCTGCAGACTCTGAGGGCACTGTCAGAAGTACAGAAAATGACGCCAAGAGAAAGGATGCGGCTGAGGAAGCTCCAGGCGGCTGATGAGAAAGCCAGGAAGCTGAAAAAGATTGTGGAAGAAAAATATGAAGAAAATAGCAAACGAATGCAAGAATTGAGATCTCGGAACTTTCAGCAGCTGAGTGTTGATGTACTCCATGAAAAAACACATTTAAAAGGAATGGAAGAAAAGGAGGAGCAACCTGAGGGAAGACTTTCTTGTTCACCCCAGGACGAGGATGAAGAGAGGTGGCAAGGCAGGGAAGAGGAATCTGATGAACCAACTTTAGAGAACCTGCCTGAGTCTCAGCCTATTCCTTCCATGGACCTCCACGAACTTGAATCAATTGTAGAGGATGCCACATCTGACCTTGGATACCATGAGATCCCAGAAGACCCACTTGTGGCTGAAGAGTACTACGCTGATGCATTTGATTCCTATTGTGAAGAGAGTGATGAGGAGGAAGAAGAAATAGCGTTAGAAAGACCAGAGAAAGAAATCAGGAATGAGGGATCCCAGCCTGCTTACAGAACAAACCAACAGGACAGTGATATCGAAGCGTTGGCCAGGTGTTTGGAAAATGTCCTGGGTTGCACTTCTCTAGACACAAAGACCATCACCACCATGGCTGAAGACATGTCCCCAGGACCACCAATTTTCAACAGTGTGATGGCCAGGACCAAGATGAAACGCATGAGGGAATCAGCCATGCAGAAGCTGGGGACAGAAGTATTTGAAGAGGTCTATAATTACCTCAAGAGAGCAAGGCATCAGAATGCTAGCGAAGCAGAGATCCGCGAGTGTTTGGAAAAAGTGGTGCCTCAAGCCAGCGACTGTTTTGAAGTGGACCAGCTCCTGTACTTTGAAGAGCAGTTGCTGATCACGATGGGAAAAGAACCTACTCTCCAGAACCATCTCTAGGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSPEFMLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLREISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGAFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDEERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYADAFDSYCEESDEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMSPGPPIFNSVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNASEAEIRECLEKVVPQASDCFEVDQLLYFEEQLLITMGKEPTLQNHL*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.