3FLAG

FBXO18

cDNA Synonyms: 
FBH1; Fbx18; hFBH1
DU Number: 
DU67367
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO 3FLAG GSGSGS NLS FBXO18
Expressed: 
3FLAG GSGSGS NLS FBXO18
Genbank: 
NM_178150.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GCGGCCGCGATGAGACGGTTTAAGCGGAAGCATCTTACTGCCATTGACTGCCAGCATTTGGCTCGGAGTCACTTGGCTGTGACCCAGCCCTTCGGTCAAAGATGGACAAACAGAGATCCGAACCATGGTCTCTATCCTAAACCGAGAACAAAAAGAGGGAGTAGGGGTCAGGGAAGTCAAAGATGCATCCCTGAGTTCTTCCTAGCAGGCAAGCAGCCGTGCACCAATGACATGGCCAAAAGCAATTCTGTTGGCCAGGACAGCTGTCAGGACTCTGAGGGTGACATGATCTTTCCTGCAGAGAGCAGCTGTGCACTGCCTCAGGAAGGCAGTGCAGGGCCGGGCTCACCAGGGTCTGCCCCGCCCTCCAGGAAGCGGTCTTGGTCCTCTGAGGAAGAGAGTAACCAGGCTACCGGGACCAGCCGGTGGGATGGAGTTTCTAAGAAAGCTCCACGGCACCATTTGTCTGTGCCATGCACAAGGCCTAGGGAGGCCAGGCAAGAAGCAGAGGACAGTACGTCTCGGCTCTCTGCGGAGTCTGGTGAAACCGACCAAGATGCTGGGGACGTGGGTCCTGATCCCATTCCTGACTCATACTATGGGCTTCTTGGGACCTTGCCCTGCCAGGAAGCACTGAGCCACATTTGCAGCCTGCCTAGTGAGGTCCTGAGGCACGTGTTTGCCTTCCTCCCGGTGGAAGACCTCTATTGGAACCTGAGCTTGGTGTGCCACTTGTGGAGGGAGATCATCAGTGACCCGCTGTTCATTCCTTGGAAGAAGCTGTACCATCGATACCTGATGAATGAAGAGCAAGCTGTCAGCAAAGTGGACGGCATCCTGTCTAACTGTGGCATAGAAAAGGAGTCAGACCTGTGTGTGCTGAACCTCATACGATACACAGCCACCACTAAGTGCTCTCCGAGTGTGGATCCCGAGAGGGTGCTGTGGAGTCTGAGGGACCACCCCCTCCTCCCCGAGGCTGAGGCGTGTGTGCGGCAACACCTCCCCGACCTCTACGCTGCTGCCGGGGGTGTCAACATCTGGGCCCTGGTGGCGGCTGTGGTGCTCCTCTCCAGCAGTGTGAATGACATCCAGCGACTGCTCTTCTGCCTCCGGAGACCCAGCTCCACGGTGACCATGCCAGATGTCACCGAGACCCTGTACTGCATAGCCGTGCTTCTCTACGCCATGAGGGAGAAGGGGATTAACATCAGCAATAGGATTCACTACAACATTTTCTATTGCCTATATCTTCAGGAGAATTCCTGCACTCAGGCCACAAAAGTTAAAGAGGAGCCATCTGTCTGGCCAGGCAAGAAAACCATCCAACTTACACATGAACAACAGCTGATTCTGAATCACAAGATGGAACCTCTCCAGGTGGTGAAAATTATGGCCTTTGCCGGCACTGGGAAGACCTCAACGCTGGTCAAGTATGCAGAGAAGTGGTCTCAGAGCAGGTTTCTGTATGTGACATTCAACAAGAGCATCGCAAAGCAGGCCGAACGCGTCTTCCCCAGCAACGTCATCTGCAAAACCTTCCACTCCATGGCCTACGGGCACATAGGGCGGAAGTACCAGTCAAAGAAGAAGTTGAATCTCTTCAAGTTAACACCCTTCATGGTCAACTCCGTCCTTGCTGAAGGGAAGGGTGGATTCATAAGAGCCAAGCTTGTGTGTAAGACTCTAGAAAACTTCTTTGCCTCGGCTGACGAAGAGCTGACCATTGATCACGTGCCTATTTGGTGTAAGAACAGCCAAGGACAGAGAGTCATGGTTGAGCAGAGTGAAAAACTGAATGGTGTCCTTGAAGCGAGCCGCCTCTGGGATAACATGCGGAAGCTGGGGGAGTGCACAGAAGAGGCGCACCAGATGACTCATGACGGCTACTTGAAACTCTGGCAGCTGAGCAAGCCTTCGCTGGCCTCTTTTGACGCCATCTTTGTGGATGAGGCCCAGGACTGCACACCAGCTATCATGAACATAGTTCTGTCTCAGCCATGTGGGAAAATCTTTGTAGGGGACCCGCACCAGCAGATCTATACCTTCCGGGGTGCGGTCAACGCCCTGTTCACAGTGCCCCACACCCACGTCTTCTATCTCACGCAGAGTTTTCGGTTTGGTGTGGAAATAGCTTATGTGGGAGCTACTATCTTGGATGTTTGCAAGAGAGTCAGGAAAAAGACTTTGGTTGGAGGAAACCATCAGAGTGGCATTAGAGGTGACGCAAAGGGGCAAGTGGCCTTGTTGTCCCGGACCAACGCCAACGTGTTTGATGAGGCCGTACGGGTGACGGAAGGGGAATTCCCTTCAAGGATACATTTGATTGGGGGGATTAAATCATTTGGATTGGACAGAATCATTGATATTTGGATCCTTCTTCAGCCAGAGGAAGAACGGAGGAAACAAAACCTCGTCATTAAAGACAAATTTATCAGAAGATGGGTGCACAAAGAAGGCTTTAGTGGCTTCAAGAGGTATGTGACCGCTGCCGAGGACAAGGAGCTTGAAGCCAAGATCGCAGTTGTTGAAAAGTATAACATCAGGATTCCAGAGCTGGTGCAAAGGATAGAAAAATGCCATATAGAAGATTTGGACTTTGCAGAGTACATTCTGGGCACTGTGCACAAAGCCAAAGGCCTGGAGTTTGACACTGTGCATGTTTTGGATGATTTTGTGAAAGTGCCTTGTGCCCGGCATAACCTGCCCCAGCTTCCGCACTTCAGAGTTGAGTCATTTTCTGAGGATGAATGGAATTTACTGTATGTTGCAGTAACTCGAGCCAAGAAGCGTCTCATCATGACCAAATCATTGGAAAACATTTTGACTTTGGCTGGGGAGTACTTCTTGCAAGCAGAGCTGACAAGCAACGTCTTAAAAACAGGCGTGGTGCGCTGCTGCGTGGGACAGTGCAACAATGCCATCCCTGTTGACACCGTCCTTACCATGAAGAAGCTGCCCATCACCTATAGCAACAGGAAGGAAAACAAGGGGGGCTACCTCTGCCACTCCTGTGCGGAGCAGCGCATCGGGCCCCTGGCGTTCCTGACAGCCTCCCCGGAGCAGGTGCGCGCCATGGAGCGCACTGTGGAGAACATCGTACTGCCCCGGCATGAGGCCCTGCTCTTCCTCGTCTTCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKDYKDDDDKDYKDDDDKGSGSGSPKKKRKVGSPGEFASLEKLAAAMRRFKRKHLTAIDCQHLARSHLAVTQPFGQRWTNRDPNHGLYPKPRT KRGSRGQGSQRCIPEFFLAGKQPCTNDMAKSNSVGQDSCQDSEGDMIFPAESSCALPQEGSAGPGSPGSAPPSRKRSWSSEEESNQATGTSRWDGVSKKA PRHHLSVPCTRPREARQEAEDSTSRLSAESGETDQDAGDVGPDPIPDSYYGLLGTLPCQEALSHICSLPSEVLRHVFAFLPVEDLYWNLSLVCHLWREII SDPLFIPWKKLYHRYLMNEEQAVSKVDGILSNCGIEKESDLCVLNLIRYTATTKCSPSVDPERVLWSLRDHPLLPEAEACVRQHLPDLYAAAGGVNIWAL VAAVVLLSSSVNDIQRLLFCLRRPSSTVTMPDVTETLYCIAVLLYAMREKGINISNRIHYNIFYCLYLQENSCTQATKVKEEPSVWPGKKTIQLTHEQQL ILNHKMEPLQVVKIMAFAGTGKTSTLVKYAEKWSQSRFLYVTFNKSIAKQAERVFPSNVICKTFHSMAYGHIGRKYQSKKKLNLFKLTPFMVNSVLAEGK GGFIRAKLVCKTLENFFASADEELTIDHVPIWCKNSQGQRVMVEQSEKLNGVLEASRLWDNMRKLGECTEEAHQMTHDGYLKLWQLSKPSLASFDAIFVD EAQDCTPAIMNIVLSQPCGKIFVGDPHQQIYTFRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGATILDVCKRVRKKTLVGGNHQSGIRGDAKGQVALL SRTNANVFDEAVRVTEGEFPSRIHLIGGIKSFGLDRIIDIWILLQPEEERRKQNLVIKDKFIRRWVHKEGFSGFKRYVTAAEDKELEAKIAVVEKYNIRI PELVQRIEKCHIEDLDFAEYILGTVHKAKGLEFDTVHVLDDFVKVPCARHNLPQLPHFRVESFSEDEWNLLYVAVTRAKKRLIMTKSLENILTLAGEYFL QAELTSNVLKTGVVRCCVGQCNNAIPVDTVLTMKKLPITYSNRKENKGGYLCHSCAEQRIGPLAFLTASPEQVRAMERTVENIVLPRHEALLFLVF*
Price: £125.00
Completion Time: 
6
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

USP26

DU Number: 
DU61188
Cost of Production: 
100.00
Plasmid: 
pCAGGS puro 3FLAG USP26 M579I
Expressed: 
3FLAG USP26 M579I
Genbank: 
NM_031907.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTGCCCTATTCCTACGTGGTTTTGTCCAAATAGGGAACTGCAAGACTGGGATATCTAAGTCAAAAGAAGCATTCATTGAAGCAGTGGAAAGAAAGAAGAAAGATAGACTGGTGCTGTATTTCAAAAGTGGAAAATATAGCACTTTTCGGCTAAGTGATAATATTCAAAATGTAGTCCTTAAATCCTATAGAGGAAACCAAAATCACCTGCATTTAACTTTACAAAATAATAATGGCTTGTTTATTGAAGGATTATCCTCCACAGATGCTGAACAATTGAAGATATTCTTGGACAGAGTTCATCAAAACGAGGTTCAGCCACCTGTGAGACCTGGTAAGGGTGGGAGTGTCTTTTCTAGCACAACACAGAAGGAAATCAACAAAACTTCATTCCACAAAGTTGATGAGAAATCAAGTAGCAAATCTTTTGAGATAGCAAAAGGAAGTGGGACAGGTGTCCTTCAGAGGATGCCTTTGCTTACATCAAAATTGACACTTACTTGCGGAGAGTTATCAGAAAATCAGCACAAGAAGAGGAAAAGAATGCTCTCATCTAGCTCAGAGATGAATGAGGAATTCTTGAAAGAAAATAATTCTGTAGAATACAAGAAATCCAAGGCAGATTGTTCGAGGTGTGTAAGCTATAATCGAGAGAAACAATTGAAGTTAAAAGAGTTAGAAGAGAATAAGAAATTGGAATGTGAATCTTCATGCATCATGAACGCCACTGGAAATCCTTACCTAGATGACATTGGTCTTCTCCAAGCTCTCACTGAGAAAATGGTTTTGGTATTTCTGTTACAACAAGGGTATAGTGACGGTTACACAAAGTGGGATAAATTAAAACTATTTTTTGAATTATTTCCAGAGAAAATATGCCACGGCCTCCCCAATTTGGGAAACACCTGTTATATGAATGCAGTGTTACAGTCTCTACTTTCAATCCCATCGTTTGCTGATGATTTACTTAATCAGAGTTTCCCATGGGGTAAAATTCCCCTTAATGCTCTTACCATGTGCTTGGCACGGCTACTTTTTTTTAAAGATACCTATAATATAGAAATCAAGGAGATGTTACTCTTGAATCTTAAAAAGGCCATTTCAGCAGCTGCAGAGATATTCCATGGCAATGCACAGAACGATGCTCATGAGTTTTTAGCTCACTGTTTAGATCAACTGAAAGATAACATGGAAAAACTCAACACAATTTGGAAGCCTAAAAGTGAATTTGGGGAAGATAATTTTCCTAAACAGGTTTTTGCTGATGATCCTGACACCAGTGGGTTTTCTTGCCCTGTCATTACTAATTTTGAGTTAGAGTTGTTGCACTCCATTGCTTGTAAAGCTTGTGGTCAGGTTATTCTCAAGACAGAACTGAATAATTACCTCTCCATCAACCTTCCCCAAAGAATAAAAGCACATCCTTCATCTATTCAGTCTACTTTTGATCTTTTTTTTGGAGCAGAAGAGCTTGAGTATAAATGTGCAAAATGTGAGCACAAGACTTCCGTTGGAGTGCACTCATTCAGTAGGCTACCTAGAATCCTTATTGTTCACCTCAAACGCTATAGCTTGAATGAGTTTTGTGCATTAAAGAAGAATGACCAGGAAGTCATCATTTCCAAATATTTAAAGGTGTCTTCTCATTGCAATGAAGGCACCAGACCACCTCTTCCCTTGAGTGAGGATGGAGAAATTACAGATTTCCAATTATTAAAAGTTATTCGAAAGATAACTTCTGGAAACATCAGTGTATCATGGCCTGCAACAAAGGAATCCAAAGATATCCTGGCTCCACACATTGGATCAGATAAGGAGTCTGAACAAAAAAAAGGCCAGACAGTCTTTAAAGGGGCAAGCAGAAGACAGCAGCAAAAGTACCTTGGAAAAAATTCTAAACCAAATGAGCTAGAATCTGTATACTCAGGAGATCGAGCATTCATTGAAAAAGAACCGTTAGCTCACTTAATGACGTATCTGGAAGATACCTCACTTTGTCAGTTCCACAAAGCTGGAGGTAAACCTGCCAGCAGCCCAGGCACACCTCTCTCAAAAGTTGACTTTCAAACAGTGCCCGAAAATCCAAAACGAAAGAAATATGTGAAAACCAGTAAGTTTGTAGCTTTTGATAGGATTATCAATCCTACTAAAGATTTGTATGAAGATAAAAATATCAGAATTCCAGAAAGATTCCAAAAAGTGTCTGAACAGACTCAGCAGTGTGACGGTATGAGAATCTGTGAACAAGCCCCTCAGCAGGCACTGCCTCAAAGCTTTCCAAAGCCAGGCACCCAGGGGCACACAAAGAACCTCCTAAGACCTACAAAATTAAATCTACAGAAGTCTAACAGGAATTCCCTACTTGCACTGGGTTCCAATAAGAATCCAAGAAACAAAGACATTTTAGATAAGATAAAATCTAAAGCCAAGGAAACAAAAAGAAATGATGATAAGGGAGATCATACCTACCGGCTCATTAGTGTTGTCAGCCATCTTGGGAAGACTCTAAAGTCAGGCCATTATATCTGTGATGCCTATGACTTTGAGAAACAGATCTGGTTCACTTACGATGATATGCGGGTGTTAGGTATCCAGGAGGCCCAGATGCAGGAGGATAGGCGTTGCACTGGGTACATCTTCTTTTACATGCATAATGAGATCTTTGAAGAGATGTTGAAAAGAGAAGAGAATGCCCAGCTTAATAGCAAGGAGGTAGAGGAGACCCTTCAGAAGGAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTL QNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFSSTTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGVLQRMPLLTSKLTLTCGELSEN QHKKRKRMLSSSSEMNEEFLKENNSVEYKKSKADCSRCVSYNREKQLKLKELEENKKLECESSCIMNATGNPYLDDIGLLQALTEKMVLVFLLQQGYSDG YTKWDKLKLFFELFPEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKDTYNIEIKEMLLLNLKKAISAAAEIF HGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQVFADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAH PSSIQSTFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKV IRKITSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGK PASSPGTPLSKVDFQTVPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP TKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRR CTGYIFFYMHNEIFEEMLKREENAQLNSKEVEETLQKE*
Price: £125.00
Completion Time: 
50
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
Ubiquitylation Site: 
Yes

USP26

DU Number: 
DU61171
Cost of Production: 
100.00
Plasmid: 
pCAGGS puro 3FLAG USP26 L364F
Expressed: 
3FLAG USP26 L364F
Genbank: 
NM_031907.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTGCCCTATTCCTACGTGGTTTTGTCCAAATAGGGAACTGCAAGACTGGGATATCTAAGTCAAAAGAAGCATTCATTGAAGCAGTGGAAAGAAAGAAGAAAGATAGACTGGTGCTGTATTTCAAAAGTGGAAAATATAGCACTTTTCGGCTAAGTGATAATATTCAAAATGTAGTCCTTAAATCCTATAGAGGAAACCAAAATCACCTGCATTTAACTTTACAAAATAATAATGGCTTGTTTATTGAAGGATTATCCTCCACAGATGCTGAACAATTGAAGATATTCTTGGACAGAGTTCATCAAAACGAGGTTCAGCCACCTGTGAGACCTGGTAAGGGTGGGAGTGTCTTTTCTAGCACAACACAGAAGGAAATCAACAAAACTTCATTCCACAAAGTTGATGAGAAATCAAGTAGCAAATCTTTTGAGATAGCAAAAGGAAGTGGGACAGGTGTCCTTCAGAGGATGCCTTTGCTTACATCAAAATTGACACTTACTTGCGGAGAGTTATCAGAAAATCAGCACAAGAAGAGGAAAAGAATGCTCTCATCTAGCTCAGAGATGAATGAGGAATTCTTGAAAGAAAATAATTCTGTAGAATACAAGAAATCCAAGGCAGATTGTTCGAGGTGTGTAAGCTATAATCGAGAGAAACAATTGAAGTTAAAAGAGTTAGAAGAGAATAAGAAATTGGAATGTGAATCTTCATGCATCATGAACGCCACTGGAAATCCTTACCTAGATGACATTGGTCTTCTCCAAGCTCTCACTGAGAAAATGGTTTTGGTATTTCTGTTACAACAAGGGTATAGTGACGGTTACACAAAGTGGGATAAATTAAAACTATTTTTTGAATTATTTCCAGAGAAAATATGCCACGGCCTCCCCAATTTGGGAAACACCTGTTATATGAATGCAGTGTTACAGTCTCTACTTTCAATCCCATCGTTTGCTGATGATTTACTTAATCAGAGTTTCCCATGGGGTAAAATTCCCCTTAATGCTCTTACCATGTGCTTGGCACGGCTACTTTTTTTTAAAGATACCTATAATATAGAAATCAAGGAGATGTTACTCTTGAATTTTAAAAAGGCCATTTCAGCAGCTGCAGAGATATTCCATGGCAATGCACAGAACGATGCTCATGAGTTTTTAGCTCACTGTTTAGATCAACTGAAAGATAACATGGAAAAACTCAACACAATTTGGAAGCCTAAAAGTGAATTTGGGGAAGATAATTTTCCTAAACAGGTTTTTGCTGATGATCCTGACACCAGTGGGTTTTCTTGCCCTGTCATTACTAATTTTGAGTTAGAGTTGTTGCACTCCATTGCTTGTAAAGCTTGTGGTCAGGTTATTCTCAAGACAGAACTGAATAATTACCTCTCCATCAACCTTCCCCAAAGAATAAAAGCACATCCTTCATCTATTCAGTCTACTTTTGATCTTTTTTTTGGAGCAGAAGAGCTTGAGTATAAATGTGCAAAATGTGAGCACAAGACTTCCGTTGGAGTGCACTCATTCAGTAGGCTACCTAGAATCCTTATTGTTCACCTCAAACGCTATAGCTTGAATGAGTTTTGTGCATTAAAGAAGAATGACCAGGAAGTCATCATTTCCAAATATTTAAAGGTGTCTTCTCATTGCAATGAAGGCACCAGACCACCTCTTCCCTTGAGTGAGGATGGAGAAATTACAGATTTCCAATTATTAAAAGTTATTCGAAAGATGACTTCTGGAAACATCAGTGTATCATGGCCTGCAACAAAGGAATCCAAAGATATCCTGGCTCCACACATTGGATCAGATAAGGAGTCTGAACAAAAAAAAGGCCAGACAGTCTTTAAAGGGGCAAGCAGAAGACAGCAGCAAAAGTACCTTGGAAAAAATTCTAAACCAAATGAGCTAGAATCTGTATACTCAGGAGATCGAGCATTCATTGAAAAAGAACCGTTAGCTCACTTAATGACGTATCTGGAAGATACCTCACTTTGTCAGTTCCACAAAGCTGGAGGTAAACCTGCCAGCAGCCCAGGCACACCTCTCTCAAAAGTTGACTTTCAAACAGTGCCCGAAAATCCAAAACGAAAGAAATATGTGAAAACCAGTAAGTTTGTAGCTTTTGATAGGATTATCAATCCTACTAAAGATTTGTATGAAGATAAAAATATCAGAATTCCAGAAAGATTCCAAAAAGTGTCTGAACAGACTCAGCAGTGTGACGGTATGAGAATCTGTGAACAAGCCCCTCAGCAGGCACTGCCTCAAAGCTTTCCAAAGCCAGGCACCCAGGGGCACACAAAGAACCTCCTAAGACCTACAAAATTAAATCTACAGAAGTCTAACAGGAATTCCCTACTTGCACTGGGTTCCAATAAGAATCCAAGAAACAAAGACATTTTAGATAAGATAAAATCTAAAGCCAAGGAAACAAAAAGAAATGATGATAAGGGAGATCATACCTACCGGCTCATTAGTGTTGTCAGCCATCTTGGGAAGACTCTAAAGTCAGGCCATTATATCTGTGATGCCTATGACTTTGAGAAACAGATCTGGTTCACTTACGATGATATGCGGGTGTTAGGTATCCAGGAGGCCCAGATGCAGGAGGATAGGCGTTGCACTGGGTACATCTTCTTTTACATGCATAATGAGATCTTTGAAGAGATGTTGAAAAGAGAAGAGAATGCCCAGCTTAATAGCAAGGAGGTAGAGGAGACCCTTCAGAAGGAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTL QNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFSSTTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGVLQRMPLLTSKLTLTCGELSEN QHKKRKRMLSSSSEMNEEFLKENNSVEYKKSKADCSRCVSYNREKQLKLKELEENKKLECESSCIMNATGNPYLDDIGLLQALTEKMVLVFLLQQGYSDG YTKWDKLKLFFELFPEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKDTYNIEIKEMLLLNFKKAISAAAEIF HGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQVFADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAH PSSIQSTFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKV IRKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGK PASSPGTPLSKVDFQTVPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP TKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRR CTGYIFFYMHNEIFEEMLKREENAQLNSKEVEETLQKE*
Price: £125.00
Completion Time: 
23
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
Ubiquitylation Site: 
Yes

USP26

DU Number: 
DU61170
Cost of Production: 
100.00
Plasmid: 
pCAGGS puro 3FLAG USP26 L165S
Expressed: 
3FLAG USP26 L165S
Genbank: 
NM_031907.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTGCCCTATTCCTACGTGGTTTTGTCCAAATAGGGAACTGCAAGACTGGGATATCTAAGTCAAAAGAAGCATTCATTGAAGCAGTGGAAAGAAAGAAGAAAGATAGACTGGTGCTGTATTTCAAAAGTGGAAAATATAGCACTTTTCGGCTAAGTGATAATATTCAAAATGTAGTCCTTAAATCCTATAGAGGAAACCAAAATCACCTGCATTTAACTTTACAAAATAATAATGGCTTGTTTATTGAAGGATTATCCTCCACAGATGCTGAACAATTGAAGATATTCTTGGACAGAGTTCATCAAAACGAGGTTCAGCCACCTGTGAGACCTGGTAAGGGTGGGAGTGTCTTTTCTAGCACAACACAGAAGGAAATCAACAAAACTTCATTCCACAAAGTTGATGAGAAATCAAGTAGCAAATCTTTTGAGATAGCAAAAGGAAGTGGGACAGGTGTCCTTCAGAGGATGCCTTTGCTTACATCAAAATCGACACTTACTTGCGGAGAGTTATCAGAAAATCAGCACAAGAAGAGGAAAAGAATGCTCTCATCTAGCTCAGAGATGAATGAGGAATTCTTGAAAGAAAATAATTCTGTAGAATACAAGAAATCCAAGGCAGATTGTTCGAGGTGTGTAAGCTATAATCGAGAGAAACAATTGAAGTTAAAAGAGTTAGAAGAGAATAAGAAATTGGAATGTGAATCTTCATGCATCATGAACGCCACTGGAAATCCTTACCTAGATGACATTGGTCTTCTCCAAGCTCTCACTGAGAAAATGGTTTTGGTATTTCTGTTACAACAAGGGTATAGTGACGGTTACACAAAGTGGGATAAATTAAAACTATTTTTTGAATTATTTCCAGAGAAAATATGCCACGGCCTCCCCAATTTGGGAAACACCTGTTATATGAATGCAGTGTTACAGTCTCTACTTTCAATCCCATCGTTTGCTGATGATTTACTTAATCAGAGTTTCCCATGGGGTAAAATTCCCCTTAATGCTCTTACCATGTGCTTGGCACGGCTACTTTTTTTTAAAGATACCTATAATATAGAAATCAAGGAGATGTTACTCTTGAATCTTAAAAAGGCCATTTCAGCAGCTGCAGAGATATTCCATGGCAATGCACAGAACGATGCTCATGAGTTTTTAGCTCACTGTTTAGATCAACTGAAAGATAACATGGAAAAACTCAACACAATTTGGAAGCCTAAAAGTGAATTTGGGGAAGATAATTTTCCTAAACAGGTTTTTGCTGATGATCCTGACACCAGTGGGTTTTCTTGCCCTGTCATTACTAATTTTGAGTTAGAGTTGTTGCACTCCATTGCTTGTAAAGCTTGTGGTCAGGTTATTCTCAAGACAGAACTGAATAATTACCTCTCCATCAACCTTCCCCAAAGAATAAAAGCACATCCTTCATCTATTCAGTCTACTTTTGATCTTTTTTTTGGAGCAGAAGAGCTTGAGTATAAATGTGCAAAATGTGAGCACAAGACTTCCGTTGGAGTGCACTCATTCAGTAGGCTACCTAGAATCCTTATTGTTCACCTCAAACGCTATAGCTTGAATGAGTTTTGTGCATTAAAGAAGAATGACCAGGAAGTCATCATTTCCAAATATTTAAAGGTGTCTTCTCATTGCAATGAAGGCACCAGACCACCTCTTCCCTTGAGTGAGGATGGAGAAATTACAGATTTCCAATTATTAAAAGTTATTCGAAAGATGACTTCTGGAAACATCAGTGTATCATGGCCTGCAACAAAGGAATCCAAAGATATCCTGGCTCCACACATTGGATCAGATAAGGAGTCTGAACAAAAAAAAGGCCAGACAGTCTTTAAAGGGGCAAGCAGAAGACAGCAGCAAAAGTACCTTGGAAAAAATTCTAAACCAAATGAGCTAGAATCTGTATACTCAGGAGATCGAGCATTCATTGAAAAAGAACCGTTAGCTCACTTAATGACGTATCTGGAAGATACCTCACTTTGTCAGTTCCACAAAGCTGGAGGTAAACCTGCCAGCAGCCCAGGCACACCTCTCTCAAAAGTTGACTTTCAAACAGTGCCCGAAAATCCAAAACGAAAGAAATATGTGAAAACCAGTAAGTTTGTAGCTTTTGATAGGATTATCAATCCTACTAAAGATTTGTATGAAGATAAAAATATCAGAATTCCAGAAAGATTCCAAAAAGTGTCTGAACAGACTCAGCAGTGTGACGGTATGAGAATCTGTGAACAAGCCCCTCAGCAGGCACTGCCTCAAAGCTTTCCAAAGCCAGGCACCCAGGGGCACACAAAGAACCTCCTAAGACCTACAAAATTAAATCTACAGAAGTCTAACAGGAATTCCCTACTTGCACTGGGTTCCAATAAGAATCCAAGAAACAAAGACATTTTAGATAAGATAAAATCTAAAGCCAAGGAAACAAAAAGAAATGATGATAAGGGAGATCATACCTACCGGCTCATTAGTGTTGTCAGCCATCTTGGGAAGACTCTAAAGTCAGGCCATTATATCTGTGATGCCTATGACTTTGAGAAACAGATCTGGTTCACTTACGATGATATGCGGGTGTTAGGTATCCAGGAGGCCCAGATGCAGGAGGATAGGCGTTGCACTGGGTACATCTTCTTTTACATGCATAATGAGATCTTTGAAGAGATGTTGAAAAGAGAAGAGAATGCCCAGCTTAATAGCAAGGAGGTAGAGGAGACCCTTCAGAAGGAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTL QNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFSSTTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGVLQRMPLLTSKSTLTCGELSEN QHKKRKRMLSSSSEMNEEFLKENNSVEYKKSKADCSRCVSYNREKQLKLKELEENKKLECESSCIMNATGNPYLDDIGLLQALTEKMVLVFLLQQGYSDG YTKWDKLKLFFELFPEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKDTYNIEIKEMLLLNLKKAISAAAEIF HGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQVFADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAH PSSIQSTFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKV IRKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGK PASSPGTPLSKVDFQTVPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP TKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRR CTGYIFFYMHNEIFEEMLKREENAQLNSKEVEETLQKE*
Price: £125.00
Completion Time: 
22
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
Ubiquitylation Site: 
Yes

USP26

DU Number: 
DU61169
Cost of Production: 
100.00
Plasmid: 
pCAGGS puro 3FLAG USP26 Q156H
Expressed: 
3FLAG USP26 Q156H
Genbank: 
NM_031907.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTGCCCTATTCCTACGTGGTTTTGTCCAAATAGGGAACTGCAAGACTGGGATATCTAAGTCAAAAGAAGCATTCATTGAAGCAGTGGAAAGAAAGAAGAAAGATAGACTGGTGCTGTATTTCAAAAGTGGAAAATATAGCACTTTTCGGCTAAGTGATAATATTCAAAATGTAGTCCTTAAATCCTATAGAGGAAACCAAAATCACCTGCATTTAACTTTACAAAATAATAATGGCTTGTTTATTGAAGGATTATCCTCCACAGATGCTGAACAATTGAAGATATTCTTGGACAGAGTTCATCAAAACGAGGTTCAGCCACCTGTGAGACCTGGTAAGGGTGGGAGTGTCTTTTCTAGCACAACACAGAAGGAAATCAACAAAACTTCATTCCACAAAGTTGATGAGAAATCAAGTAGCAAATCTTTTGAGATAGCAAAAGGAAGTGGGACAGGTGTCCTTCATAGGATGCCTTTGCTTACATCAAAATTGACACTTACTTGCGGAGAGTTATCAGAAAATCAGCACAAGAAGAGGAAAAGAATGCTCTCATCTAGCTCAGAGATGAATGAGGAATTCTTGAAAGAAAATAATTCTGTAGAATACAAGAAATCCAAGGCAGATTGTTCGAGGTGTGTAAGCTATAATCGAGAGAAACAATTGAAGTTAAAAGAGTTAGAAGAGAATAAGAAATTGGAATGTGAATCTTCATGCATCATGAACGCCACTGGAAATCCTTACCTAGATGACATTGGTCTTCTCCAAGCTCTCACTGAGAAAATGGTTTTGGTATTTCTGTTACAACAAGGGTATAGTGACGGTTACACAAAGTGGGATAAATTAAAACTATTTTTTGAATTATTTCCAGAGAAAATATGCCACGGCCTCCCCAATTTGGGAAACACCTGTTATATGAATGCAGTGTTACAGTCTCTACTTTCAATCCCATCGTTTGCTGATGATTTACTTAATCAGAGTTTCCCATGGGGTAAAATTCCCCTTAATGCTCTTACCATGTGCTTGGCACGGCTACTTTTTTTTAAAGATACCTATAATATAGAAATCAAGGAGATGTTACTCTTGAATCTTAAAAAGGCCATTTCAGCAGCTGCAGAGATATTCCATGGCAATGCACAGAACGATGCTCATGAGTTTTTAGCTCACTGTTTAGATCAACTGAAAGATAACATGGAAAAACTCAACACAATTTGGAAGCCTAAAAGTGAATTTGGGGAAGATAATTTTCCTAAACAGGTTTTTGCTGATGATCCTGACACCAGTGGGTTTTCTTGCCCTGTCATTACTAATTTTGAGTTAGAGTTGTTGCACTCCATTGCTTGTAAAGCTTGTGGTCAGGTTATTCTCAAGACAGAACTGAATAATTACCTCTCCATCAACCTTCCCCAAAGAATAAAAGCACATCCTTCATCTATTCAGTCTACTTTTGATCTTTTTTTTGGAGCAGAAGAGCTTGAGTATAAATGTGCAAAATGTGAGCACAAGACTTCCGTTGGAGTGCACTCATTCAGTAGGCTACCTAGAATCCTTATTGTTCACCTCAAACGCTATAGCTTGAATGAGTTTTGTGCATTAAAGAAGAATGACCAGGAAGTCATCATTTCCAAATATTTAAAGGTGTCTTCTCATTGCAATGAAGGCACCAGACCACCTCTTCCCTTGAGTGAGGATGGAGAAATTACAGATTTCCAATTATTAAAAGTTATTCGAAAGATGACTTCTGGAAACATCAGTGTATCATGGCCTGCAACAAAGGAATCCAAAGATATCCTGGCTCCACACATTGGATCAGATAAGGAGTCTGAACAAAAAAAAGGCCAGACAGTCTTTAAAGGGGCAAGCAGAAGACAGCAGCAAAAGTACCTTGGAAAAAATTCTAAACCAAATGAGCTAGAATCTGTATACTCAGGAGATCGAGCATTCATTGAAAAAGAACCGTTAGCTCACTTAATGACGTATCTGGAAGATACCTCACTTTGTCAGTTCCACAAAGCTGGAGGTAAACCTGCCAGCAGCCCAGGCACACCTCTCTCAAAAGTTGACTTTCAAACAGTGCCCGAAAATCCAAAACGAAAGAAATATGTGAAAACCAGTAAGTTTGTAGCTTTTGATAGGATTATCAATCCTACTAAAGATTTGTATGAAGATAAAAATATCAGAATTCCAGAAAGATTCCAAAAAGTGTCTGAACAGACTCAGCAGTGTGACGGTATGAGAATCTGTGAACAAGCCCCTCAGCAGGCACTGCCTCAAAGCTTTCCAAAGCCAGGCACCCAGGGGCACACAAAGAACCTCCTAAGACCTACAAAATTAAATCTACAGAAGTCTAACAGGAATTCCCTACTTGCACTGGGTTCCAATAAGAATCCAAGAAACAAAGACATTTTAGATAAGATAAAATCTAAAGCCAAGGAAACAAAAAGAAATGATGATAAGGGAGATCATACCTACCGGCTCATTAGTGTTGTCAGCCATCTTGGGAAGACTCTAAAGTCAGGCCATTATATCTGTGATGCCTATGACTTTGAGAAACAGATCTGGTTCACTTACGATGATATGCGGGTGTTAGGTATCCAGGAGGCCCAGATGCAGGAGGATAGGCGTTGCACTGGGTACATCTTCTTTTACATGCATAATGAGATCTTTGAAGAGATGTTGAAAAGAGAAGAGAATGCCCAGCTTAATAGCAAGGAGGTAGAGGAGACCCTTCAGAAGGAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTL QNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFSSTTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGVLHRMPLLTSKLTLTCGELSEN QHKKRKRMLSSSSEMNEEFLKENNSVEYKKSKADCSRCVSYNREKQLKLKELEENKKLECESSCIMNATGNPYLDDIGLLQALTEKMVLVFLLQQGYSDG YTKWDKLKLFFELFPEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKDTYNIEIKEMLLLNLKKAISAAAEIF HGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQVFADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAH PSSIQSTFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKV IRKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGK PASSPGTPLSKVDFQTVPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP TKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRR CTGYIFFYMHNEIFEEMLKREENAQLNSKEVEETLQKE*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
Ubiquitylation Site: 
Yes

USP26

DU Number: 
DU61166
Cost of Production: 
100.00
Plasmid: 
pCAGGS puro 3FLAG USP26 V154I
Expressed: 
3FLAG USP26 V154I
Genbank: 
NM_031907.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTGCCCTATTCCTACGTGGTTTTGTCCAAATAGGGAACTGCAAGACTGGGATATCTAAGTCAAAAGAAGCATTCATTGAAGCAGTGGAAAGAAAGAAGAAAGATAGACTGGTGCTGTATTTCAAAAGTGGAAAATATAGCACTTTTCGGCTAAGTGATAATATTCAAAATGTAGTCCTTAAATCCTATAGAGGAAACCAAAATCACCTGCATTTAACTTTACAAAATAATAATGGCTTGTTTATTGAAGGATTATCCTCCACAGATGCTGAACAATTGAAGATATTCTTGGACAGAGTTCATCAAAACGAGGTTCAGCCACCTGTGAGACCTGGTAAGGGTGGGAGTGTCTTTTCTAGCACAACACAGAAGGAAATCAACAAAACTTCATTCCACAAAGTTGATGAGAAATCAAGTAGCAAATCTTTTGAGATAGCAAAAGGAAGTGGGACAGGTATCCTTCAGAGGATGCCTTTGCTTACATCAAAATTGACACTTACTTGCGGAGAGTTATCAGAAAATCAGCACAAGAAGAGGAAAAGAATGCTCTCATCTAGCTCAGAGATGAATGAGGAATTCTTGAAAGAAAATAATTCTGTAGAATACAAGAAATCCAAGGCAGATTGTTCGAGGTGTGTAAGCTATAATCGAGAGAAACAATTGAAGTTAAAAGAGTTAGAAGAGAATAAGAAATTGGAATGTGAATCTTCATGCATCATGAACGCCACTGGAAATCCTTACCTAGATGACATTGGTCTTCTCCAAGCTCTCACTGAGAAAATGGTTTTGGTATTTCTGTTACAACAAGGGTATAGTGACGGTTACACAAAGTGGGATAAATTAAAACTATTTTTTGAATTATTTCCAGAGAAAATATGCCACGGCCTCCCCAATTTGGGAAACACCTGTTATATGAATGCAGTGTTACAGTCTCTACTTTCAATCCCATCGTTTGCTGATGATTTACTTAATCAGAGTTTCCCATGGGGTAAAATTCCCCTTAATGCTCTTACCATGTGCTTGGCACGGCTACTTTTTTTTAAAGATACCTATAATATAGAAATCAAGGAGATGTTACTCTTGAATCTTAAAAAGGCCATTTCAGCAGCTGCAGAGATATTCCATGGCAATGCACAGAACGATGCTCATGAGTTTTTAGCTCACTGTTTAGATCAACTGAAAGATAACATGGAAAAACTCAACACAATTTGGAAGCCTAAAAGTGAATTTGGGGAAGATAATTTTCCTAAACAGGTTTTTGCTGATGATCCTGACACCAGTGGGTTTTCTTGCCCTGTCATTACTAATTTTGAGTTAGAGTTGTTGCACTCCATTGCTTGTAAAGCTTGTGGTCAGGTTATTCTCAAGACAGAACTGAATAATTACCTCTCCATCAACCTTCCCCAAAGAATAAAAGCACATCCTTCATCTATTCAGTCTACTTTTGATCTTTTTTTTGGAGCAGAAGAGCTTGAGTATAAATGTGCAAAATGTGAGCACAAGACTTCCGTTGGAGTGCACTCATTCAGTAGGCTACCTAGAATCCTTATTGTTCACCTCAAACGCTATAGCTTGAATGAGTTTTGTGCATTAAAGAAGAATGACCAGGAAGTCATCATTTCCAAATATTTAAAGGTGTCTTCTCATTGCAATGAAGGCACCAGACCACCTCTTCCCTTGAGTGAGGATGGAGAAATTACAGATTTCCAATTATTAAAAGTTATTCGAAAGATGACTTCTGGAAACATCAGTGTATCATGGCCTGCAACAAAGGAATCCAAAGATATCCTGGCTCCACACATTGGATCAGATAAGGAGTCTGAACAAAAAAAAGGCCAGACAGTCTTTAAAGGGGCAAGCAGAAGACAGCAGCAAAAGTACCTTGGAAAAAATTCTAAACCAAATGAGCTAGAATCTGTATACTCAGGAGATCGAGCATTCATTGAAAAAGAACCGTTAGCTCACTTAATGACGTATCTGGAAGATACCTCACTTTGTCAGTTCCACAAAGCTGGAGGTAAACCTGCCAGCAGCCCAGGCACACCTCTCTCAAAAGTTGACTTTCAAACAGTGCCCGAAAATCCAAAACGAAAGAAATATGTGAAAACCAGTAAGTTTGTAGCTTTTGATAGGATTATCAATCCTACTAAAGATTTGTATGAAGATAAAAATATCAGAATTCCAGAAAGATTCCAAAAAGTGTCTGAACAGACTCAGCAGTGTGACGGTATGAGAATCTGTGAACAAGCCCCTCAGCAGGCACTGCCTCAAAGCTTTCCAAAGCCAGGCACCCAGGGGCACACAAAGAACCTCCTAAGACCTACAAAATTAAATCTACAGAAGTCTAACAGGAATTCCCTACTTGCACTGGGTTCCAATAAGAATCCAAGAAACAAAGACATTTTAGATAAGATAAAATCTAAAGCCAAGGAAACAAAAAGAAATGATGATAAGGGAGATCATACCTACCGGCTCATTAGTGTTGTCAGCCATCTTGGGAAGACTCTAAAGTCAGGCCATTATATCTGTGATGCCTATGACTTTGAGAAACAGATCTGGTTCACTTACGATGATATGCGGGTGTTAGGTATCCAGGAGGCCCAGATGCAGGAGGATAGGCGTTGCACTGGGTACATCTTCTTTTACATGCATAATGAGATCTTTGAAGAGATGTTGAAAAGAGAAGAGAATGCCCAGCTTAATAGCAAGGAGGTAGAGGAGACCCTTCAGAAGGAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSMAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTL QNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFSSTTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGILQRMPLLTSKLTLTCGELSEN QHKKRKRMLSSSSEMNEEFLKENNSVEYKKSKADCSRCVSYNREKQLKLKELEENKKLECESSCIMNATGNPYLDDIGLLQALTEKMVLVFLLQQGYSDG YTKWDKLKLFFELFPEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKDTYNIEIKEMLLLNLKKAISAAAEIF HGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQVFADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAH PSSIQSTFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKV IRKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGK PASSPGTPLSKVDFQTVPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP TKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRR CTGYIFFYMHNEIFEEMLKREENAQLNSKEVEETLQKE*
Price: £125.00
Completion Time: 
20
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
Ubiquitylation Site: 
Yes

PINK1

cDNA Synonyms: 
BRPK; PARK6
DU Number: 
DU61165
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO PINK1 S230A 3FLAG
Expressed: 
PINK1 S230A 3FLAG
Genbank: 
NM_032409.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCGCCACCATGGCGGTGCGACAGGCGCTGGGCCGCGGCCTGCAGCTGGGTCGAGCGCTGCTGCTGCGCTTCACGGGCAAGCCCGGCCGGGCCTACGGCTTGGGGCGGCCGGGCCCGGCGGCGGGCTGTGTCCGCGGGGAGCGTCCAGGCTGGGCCGCAGGACCGGGCGCGGAGCCTCGCAGGGTCGGGCTCGGGCTCCCTAACCGTCTCCGCTTCTTCCGCCAGTCGGTGGCCGGGCTGGCGGCGCGGTTGCAGCGGCAGTTCGTGGTGCGGGCCTGGGGCTGCGCGGGCCCTTGCGGCCGGGCAGTCTTTCTGGCCTTCGGGCTAGGGCTGGGCCTCATCGAGGAAAAACAGGCGGAGAGCCGGCGGGCGGTCTCGGCCTGTCAGGAGATCCAGGCAATTTTTACCCAGAAAAGCAAGCCGGGGCCTGACCCGTTGGACACGAGACGCTTGCAGGGCTTTCGGCTGGAGGAGTATCTGATAGGGCAGTCCATTGGTAAGGGCTGCAGTGCTGCTGTGTATGAAGCCACCATGCCTACATTGCCCCAGAACCTGGAGGTGACAAAGAGCACCGGGTTGCTTCCAGGGAGAGGCCCAGGTACCAGTGCACCAGGAGAAGGGCAGGAGCGAGCTCCGGGGGCCCCTGCCTTCCCCTTGGCCATCAAGATGATGTGGAACATCTCGGCAGGTTCCTCCGCCGAAGCCATCTTGAACACAATGAGCCAGGAGCTGGTCCCAGCGAGCCGAGTGGCCTTGGCTGGGGAGTATGGAGCAGTCACTTACAGAAAATCCAAGAGAGGTCCCAAGCAACTAGCCCCTCACCCCAACATCATCCGGGTTCTCCGCGCCTTCACCTCTTCCGTGCCGCTGCTGCCAGGGGCCCTGGTCGACTACCCTGATGTGCTGCCCTCACGCCTCCACCCTGAAGGCCTGGGCCATGGCCGGACGCTGTTCCTCGTTATGAAGAACTATCCCTGTACCCTGCGCCAGTACCTTTGTGTGAACACACCCAGCCCCCGCCTCGCCGCCATGATGCTGCTGCAGCTGCTGGAAGGCGTGGACCATCTGGTTCAACAGGGCATCGCGCACAGAGACCTGAAATCCGACAACATCCTTGTGGAGCTGGACCCAGACGGCTGCCCCTGGCTGGTGATCGCAGATTTTGGCTGCTGCCTGGCTGATGAGAGCATCGGCCTGCAGTTGCCCTTCAGCAGCTGGTACGTGGATCGGGGCGGAAACGGCTGTCTGATGGCCCCAGAGGTGTCCACGGCCCGTCCTGGCCCCAGGGCAGTGATTGACTACAGCAAGGCTGATGCCTGGGCAGTGGGAGCCATCGCCTATGAAATCTTCGGGCTTGTCAATCCCTTCTACGGCCAGGGCAAGGCCCACCTTGAAAGCCGCAGCTACCAAGAGGCTCAGCTACCTGCACTGCCCGAGTCAGTGCCTCCAGACGTGAGACAGTTGGTGAGGGCACTGCTCCAGCGAGAGGCCAGCAAGAGACCATCTGCCCGAGTAGCCGCAAATGTGCTTCATCTAAGCCTCTGGGGTGAACATATTCTAGCCCTGAAGAATCTGAAGTTAGACAAGATGGTTGGCTGGCTCCTCCAACAATCGGCCGCCACTTTGTTGGCCAACAGGCTCACAGAGAAGTGTTGTGTGGAAACAAAAATGAAGATGCTCTTTCTGGCTAACCTGGAGTGTGAAACGCTCTGCCAGGCAGCCCTCCTCCTCTGCTCATGGAGGGCAGCCCTGGACTACATGGACGACGATGACAAGGACTACAAGGACGACGATGACAAGGACTACAAGGACGACGATGACAAGTAGAATTC
Amino Acid Sequence: 
MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAV FLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSA PGEGQERAPGAPAFPLAIKMMWNISAGSSAEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLP SRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPF SSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALLQREASKRPSA RVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAALDYMDDDDKDYKDDDDKDYK DDDDK*
Price: £125.00
Completion Time: 
24
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.802992.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

DTL

cDNA Synonyms: 
DCAF2
DU Number: 
DU67346
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO DTL 3FLAG
Expressed: 
DTL 3FLAG
Genbank: 
NM_016448.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCGCCACCATGCTCTTCAATTCGGTGCTCCGCCAGCCCCAGCTTGGCGTCCTGAGAAATGGATGGTCTTCACAATACCCTCTTCAATCCCTTCTGACTGGTTATCAGTGCAGTGGTAATGATGAACACACTTCTTATGGAGAAACAGGAGTCCCAGTTCCTCCTTTTGGATGTACCTTCTCTTCTGCTCCCAATATGGAACATGTACTAGCAGTTGCCAATGAAGAAGGCTTTGTTCGATTGTATAACACAGAATCACAAAGTTTCAGAAAGAAGTGCTTCAAAGAATGGATGGCTCACTGGAATGCCGTCTTTGACCTGGCCTGGGTTCCTGGTGAACTTAAACTTGTTACAGCAGCAGGTGATCAAACAGCCAAATTTTGGGACGTAAAAGCTGGTGAGCTGATTGGAACATGCAAAGGTCATCAATGCAGCCTCAAGTCAGTTGCCTTTTCTAAGTTTGAGAAAGCTGTATTCTGTACGGGTGGAAGAGATGGCAACATTATGGTCTGGGATACCAGGTGCAACAAAAAAGATGGGTTTTATAGGCAAGTGAATCAAATCAGTGGAGCTCACAATACCTCAGACAAGCAAACCCCTTCAAAACCCAAGAAGAAACAGAATTCAAAAGGACTTGCTCCTTCTGTGGATTTCCAGCAAAGTGTTACTGTGGTCCTCTTTCAAGACGAGAATACCTTAGTCTCAGCAGGAGCTGTGGATGGGATAATCAAAGTATGGGATTTACGTAAGAATTATACTGCTTATCGACAAGAACCCATAGCATCCAAGTCTTTCCTGTACCCAGGTAGCAGCACTCGAAAACTTGGATATTCAAGTCTGATTTTGGATTCCACTGGCTCTACTTTATTTGCTAATTGCACAGACGATAACATCTACATGTTTAATATGACTGGGTTGAAGACTTCTCCAGTGGCTATTTTCAATGGACACCAGAACTCTACCTTTTATGTAAAATCCAGCCTTAGTCCAGATGACCAGTTTTTAGTCAGTGGCTCAAGTGATGAAGCTGCCTACATATGGAAGGTCTCCACACCCTGGCAACCTCCTACTGTGCTCCTGGGTCATTCTCAAGAGGTCACGTCTGTGTGCTGGTGTCCATCTGACTTCACAAAGATTGCTACCTGTTCTGATGACAATACACTAAAAATCTGGCGCTTGAATAGAGGCTTAGAGGAGAAACCAGGAGGTGATAAACTTTCCACGGTGGGTTGGGCCTCTCAGAAGAAAAAAGAGTCAAGACCTGGCCTAGTAACAGTAACGAGTAGCCAGAGTACTCCTGCCAAAGCCCCCAGGGCAAAGTGCAATCCATCCAATTCTTCCCCGTCATCCGCAGCTTGTGCCCCAAGCTGTGCTGGAGACCTCCCTCTTCCTTCAAATACTCCTACGTTCTCTATTAAAACCTCTCCTGCCAAGGCCCGGTCTCCCATCAACAGAAGAGGCTCTGTCTCCTCCGTCTCTCCCAAGCCACCTTCATCTTTCAAGATGTCGATTAGAAACTGGGTGACCCGAACACCTTCCTCATCACCACCCATCACTCCACCTGCTTCGGAGACCAAGATCATGTCTCCGAGAAAAGCCCTTATTCCTGTGAGCCAGAAGTCATCCCAAGCAGAGGCTTGCTCTGAGTCTAGAAATAGAGTAAAGAGGAGGCTAGACTCAAGCTGTCTGGAGAGTGTGAAACAAAAGTGTGTGAAGAGTTGTAACTGTGTGACTGAGCTTGATGGCCAAGTTGAAAATCTTCATTTGGATCTGTGCTGCCTTGCTGGTAACCAGGAAGACCTTAGTAAGGACTCTCTAGGTCCTACCAAATCAAGCAAAATTGAAGGAGCTGGTACCAGTATCTCAGAGCCTCCGTCTCCTATCAGTCCGTATGCTTCAGAAAGCTGTGGAACGCTACCTCTTCCTTTGAGACCTTGTGGAGAAGGGTCTGAAATGGTAGGCAAAGAGAATAGTTCCCCAGAGAATAAAAACTGGTTGTTGGCCATGGCAGCCAAACGGAAGGCTGAGAATCCATCTCCACGAAGTCCGTCATCCCAGACACCCAATTCCAGGAGACAGAGCGGAAAGAAATTGCCAAGCCCGGTCACCATCACGCCCAGCTCCATGAGGAAAATCTGCACATACTTCCATAGAAAGTCCCAGGAGGACTTCTGTGGTCCTGAACACTCAACAGAATTAGCGGCCGC
Amino Acid Sequence: 
MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSAPNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNA VFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYRQVNQISGAHNTSDKQTPSKP KKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCTDDNIYMFNM TGLKTSPVAIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIWKVSTPWQPPTVLLGHSQEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLEEKPGG DKLSTVGWASQKKKESRPGLVTVTSSQSTPAKAPRAKCNPSNSSPSSAACAPSCAGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVSPKPPSSFKMS IRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQAEACSESRNRVKRRLDSSCLESVKQKCVKSCNCVTELDGQVENLHLDLCCLAGNQEDLSK DSLGPTKSSKIEGAGTSISEPPSPISPYASESCGTLPLPLRPCGEGSEMVGKENSSPENKNWLLAMAAKRKAENPSPRSPSSQTPNSRRQSGKKLPSPVT ITPSSMRKICTYFHRKSQEDFCGPEHSTELAAADYKDDDDKDYKDDDDKDYKDDDDK*
Price: £125.00
Completion Time: 
10
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WDR5B

DU Number: 
DU67336
Cost of Production: 
100.00
Plasmid: 
pcDNA5 FRT/TO WDR5B 3FLAG
Expressed: 
WDR5B 3FLAG
Genbank: 
NM_019069.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCgccaccATGGCAACCAAGGAGTCAAGAGACGCCAAAGCACAGTTGGCCCTCTCCTCATCGGCCAATCAGAGCAAGGAAGTGCCTGAAAACCCAAACTATGCTCTCAAATGTACTCTTGTGGGACACACGGAAGCAGTGTCATCAGTTAAGTTTAGTCCTAATGGAGAATGGCTAGCAAGTTCTTCTGCTGATAGGCTAATCATAATTTGGGGAGCATATGATGGAAAATATGAGAAAACACTCTATGGTCATAATTTGGAAATATCGGATGTTGCCTGGTCATCAGATTCCAGTCGTCTTGTTTCTGCCTCAGATGATAAAACTCTAAAATTATGGGATGTGAGATCTGGAAAATGTTTGAAAACACTGAAGGGGCACAGTAATTATGTCTTTTGTTGTAACTTCAATCCGCCATCCAACCTTATAATCTCGGGATCTTTTGATGAGACTGTAAAAATATGGGAGGTGAAAACAGGAAAGTGTCTCAAGACTTTGTCTGCTCATTCTGACCCAGTTTCTGCTGTTCATTTTAATTGTAGTGGGTCCTTGATAGTGTCAGGTAGCTATGATGGCCTCTGTAGAATCTGGGATGCTGCATCAGGTCAGTGTTTAAAAACGCTCGTTGATGACGATAACCCTCCTGTCTCTTTTGTAAAATTTTCTCCAAATGGTAAATACATTCTCACTGCAACTTTGGACAACACTCTTAAACTATGGGATTATAGCAGAGGCAGGTGCCTGAAAACATACACTGGTCATAAGAATGAGAAATATTGCATATTTGCCAATTTTTCAGTTACTGGTGGAAAGTGGATTGTGTCTGGTTCCGAGGATAACCTGGTTTACATTTGGAACCTTCAGACTAAAGAGATTGTGCAGAAATTACAAGGCCATACAGATGTTGTGATCTCAGCAGCTTGTCATCCTACAGAAAACCTCATCGCATCAGCAGCATTAGAAAATGACAAAACAATTAAACTGTGGATGAGTAACCACGCGGCCGC
Amino Acid Sequence: 
MATKESRDAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSSRLVS ASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQ CLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVV ISAACHPTENLIASAALENDKTIKLWMSNHAAADYKDDDDKDYKDDDDKDYKDDDDK*
Price: £125.00
Completion Time: 
5
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

WDR76

cDNA Synonyms: 
CDW14
DU Number: 
DU67335
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO WDR76 3FLAG
Expressed: 
WDR76 3FLAG
Genbank: 
NM_024908.3 with residue change S153A (Natural variant,RNA-derived)
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
aGATCTATGTCCAGGTCGGGCGCGGCGGCTGAGAAGGCGGACTCCAGACAGCGACCCCAGATGAAGGTAAATGAATATAAAGAAAATCAAAACATCGCTTATGTGTCTCTGAGACCAGCACAGACTACAGTTTTAATAAAAACAGCTAAGGTCTATCTTGCCCCCTTTTCACTCAGTAATTACCAGCTAGACCAGCTTATGTGCCCCAAATCCCTATCAGAAAAGAATTCTAACAATGAAGTGGCGTGTAAGAAGACTAAAATAAAGAAAACTTGCAGAAGGATTATACCTCCAAAGATGAAAAACACATCTTCCAAGGCAGAATCCACGCTGCAAAATTCATCCTCAGCTGTTCATACTGAAAGTAACAAGCTACAACCCAAGAGAACGGCAGATGCGATGAATCTCAGTGTTGATGTGGAAAGTAGTCAGGATGGAGACAGTGATGAAGATACCACACCAGCCCTGGATTTTTCGGGATTGTCACCCTACGAAAGGAAGAGACTGAAGAACATATCAGAAAACGCAGACTTTTTTGCTTCTCTTCAGTTGTCTGAGTCTGCTGCAAGACTCCGTGAAATGATAGAGAAGAGACAGCCTCCTAAATCCAAAAGAAAGAAGCCTAAGAGAGAAAATGGGATTGGATGTAGAAGGTCAATGCGATTACTAAAAGTTGATCCTTCGGGAGTTTCATTACCAGCAGCTCCAACACCGCCGACATTAGTAGCAGATGAAACTCCTTTGTTACCTCCTGGGCCTTTAGAAATGACTTCTGAAAATCAAGAAGACAACAATGAACGATTTAAAGGATTTCTGCACACATGGGCAGGAATGAGCAAGCCAAGTAGTAAGAACACTGAGAAGGGATTATCTAGCATTAAAAGCTACAAAGCCAATTTAAATGGCATGGTCATTAGTGAAGATACCGTTTACAAAGTTACCACAGGCCCAATATTCTCTATGGCTCTCCATCCATCAGAAACTAGAACTTTGGTAGCAGTTGGGGCCAAATTTGGGCAAGTTGGACTTTGTGATTTGACCCAGCAACCTAAAGAAGATGGAGTTTATGTTTTTCATCCCCATAGTCAGCCAGTTAGCTGTCTTTACTTCTCACCCGCCAATCCGGCCCACATACTGTCACTGAGCTATGATGGCACGTTACGCTGTGGGGATTTTTCCAGGGCTATTTTTGAAGAGGTGTATAGAAATGAAAGAAGTAGCTTTTCCTCCTTCGACTTCTTGGCAGAAGATGCCTCCACTTTAATAGTAGGACACTGGGATGGAAATATGTCACTGGTGGATAGACGGACACCTGGAACTTCTTATGAGAAACTTACCAGTTCTTCTATGGGAAAAATAAGAACTGTTCATGTCCACCCAGTGCATAGACAGTATTTTATCACTGCCGGATTGAGGGATACTCATATTTATGATGCAAGGCGATTGAATTCCAGGAGAAGTCAGCCTTTGATTTCTTTGACTGAACATACAAAGAGCATTGCTTCCGCCTATTTTTCACCTCTTACTGGTAACAGAGTGGTGACCACATGTGCTGATTGTAATCTGAGAATTTTTGACAGCAGCTGTATATCTTCTAAGATTCCGCTCCTCACCACCATCAGGCACAACACTTTCACTGGGCGATGGCTGACCAGGTTCCAAGCCATGTGGGATCCTAAACAAGAAGACTGTGTCATAGTTGGCAGCATGGCCCATCCACGACGGGTAGAAATCTTCCATGAGACAGGAAAGAGGGTGCATTCGTTTGGTGGAGAATACCTTGTCTCTGTGTGTTCCATCAATGCCATGCACCCAACTCGGTATATTTTGGCTGGAGGTAATTCCAGCGGGAAGATACATGTTTTTATGAATGAAAAAAGCTGCGCGGCCGC
Amino Acid Sequence: 
MSRSGAAAEKADSRQRPQMKVNEYKENQNIAYVSLRPAQTTVLIKTAKVYLAPFSLSNYQLDQLMCPKSLSEKNSNNEVACKKTKIKKTCRRIIPPKMKN TSSKAESTLQNSSSAVHTESNKLQPKRTADAMNLSVDVESSQDGDSDEDTTPALDFSGLSPYERKRLKNISENADFFASLQLSESAARLREMIEKRQPPK SKRKKPKRENGIGCRRSMRLLKVDPSGVSLPAAPTPPTLVADETPLLPPGPLEMTSENQEDNNERFKGFLHTWAGMSKPSSKNTEKGLSSIKSYKANLNG MVISEDTVYKVTTGPIFSMALHPSETRTLVAVGAKFGQVGLCDLTQQPKEDGVYVFHPHSQPVSCLYFSPANPAHILSLSYDGTLRCGDFSRAIFEEVYR NERSSFSSFDFLAEDASTLIVGHWDGNMSLVDRRTPGTSYEKLTSSSMGKIRTVHVHPVHRQYFITAGLRDTHIYDARRLNSRRSQPLISLTEHTKSIAS AYFSPLTGNRVVTTCADCNLRIFDSSCISSKIPLLTTIRHNTFTGRWLTRFQAMWDPKQEDCVIVGSMAHPRRVEIFHETGKRVHSFGGEYLVSVCSINA MHPTRYILAGGNSSGKIHVFMNEKSCAAADYKDDDDKDYKDDDDKDYKDDDDK*
Price: £125.00
Completion Time: 
5
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.