3FLAG

CDKL5

cDNA Synonyms: 
EIEE2; ISSX; STK9
DU Number: 
DU67579
Cost of Production: 
200.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG CDKL5 R559*
Expressed: 
3Flag-CDKL5 R559*
Genbank: 
NM_003159.2 GI:83367066 with silent changes t996c and t2118c
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGAGTTGTACTTAAATGCAGACACAAGGAAACACATGAAATTGTGGCGATCAAGAAATTCAAGGACAGTGAAGAAAATGAAGAAGTCAAAGAAACGACTTTACGAGAGCTTAAAATGCTTCGGACTCTCAAGCAGGAAAACATTGTGGAGTTGAAGGAAGCATTTCGTCGGAGGGGAAAGTTGTACTTGGTGTTTGAGTATGTTGAAAAAAATATGCTCGAATTGCTGGAAGAAATGCCAAATGGAGTTCCACCTGAGAAAGTAAAAAGCTACATCTATCAGCTAATCAAGGCTATTCACTGGTGCCATAAGAATGATATTGTCCATCGAGATATAAAACCAGAAAATCTCTTAATCAGCCACAATGATGTCCTAAAACTGTGTGACTTTGGTTTTGCTCGTAATCTGTCAGAAGGCAATAATGCTAATTACACAGAGTACGTTGCCACCAGATGGTATCGGTCCCCAGAACTCTTACTTGGCGCTCCCTATGGAAAGTCCGTGGACATGTGGTCGGTGGGCTGTATTCTTGGGGAGCTTAGCGATGGACAGCCTTTATTTCCTGGAGAAAGTGAAATTGACCAACTTTTTACTATTCAGAAGGTGCTAGGACCACTTCCATCTGAGCAGATGAAGCTTTTCTACAGTAATCCTCGCTTCCATGGGCTCCGGTTTCCAGCTGTTAACCATCCTCAGTCCTTGGAAAGAAGATACCTTGGAATTTTGAATAGTGTTCTACTTGACCTAATGAAGAATTTACTGAAGTTGGACCCAGCTGACAGATACTTGACAGAACAGTGTTTGAATCACCCTACATTTCAAACCCAGAGACTTCTGGATCGTTCTCCTTCAAGGTCAGCAAAAAGAAAACCTTACCATGTGGAAAGCAGCACATTGTCTAATAGAAACCAAGCCGGCAAAAGCACTGCTTTGCAGTCTCACCACAGATCTAACAGCAAGGACATCCAGAACCTGAGTGTAGGCCTGCCCCGGGCTGACGAAGGTCTCCCTGCCAATGAAAGCTTCCTAAATGGAAACCTTGCTGGAGCTAGTCTTAGTCCACTGCACACCAAAACCTACCAAGCAAGCAGCCAGCCTGGGTCTACCAGCAAAGATCTCACCAACAACAACATACCACACCTTCTTAGCCCAAAAGAAGCCAAGTCAAAAACAGAGTTTGATTTTAATATTGACCCAAAGCCTTCAGAAGGCCCAGGGACAAAGTACCTCAAGTCAAACAGCAGATCTCAGCAGAACCGCCACTCATTCATGGAAAGCTCTCAAAGCAAAGCTGGGACACTGCAGCCCAATGAAAAGCAGAGTCGGCATAGCTATATTGACACAATTCCCCAGTCCTCTAGGAGTCCCTCCTACAGGACCAAGGCCAAAAGCCATGGGGCACTGAGTGACTCCAAGTCTGTGAGCAACCTTTCTGAAGCCAGGGCCCAAATTGCGGAGCCCAGTACCAGTAGGTACTTCCCATCTAGCTGCTTAGACTTGAATTCTCCCACCAGCCCAACCCCCACCAGACACAGTGACACGAGAACTTTGCTCAGCCCTTCTGGAAGAAATAACCGAAATGAGGGAACGCTGGACTCACGTTGAACCACAACCAGACATTCTAAGACGATGGAGGAATTGAAGCTGCCGGAGCACATGGACAGTAGCCATTCCCATTCACTGTCTGCACCTCACGAATCTTTTTCTTATGGACTGGGCTACACCAGCCCCTTTTCTTCCCAGCAACGTCCTCATAGGCATTCTATGTATGTGACCCGTGACAAAGTGAGAGCCAAGGGCTTGGATGGAAGCTTGAGCATAGGGCAAGGGATGGCAGCTAGAGCCAACAGCCTGCAACTCTTGTCACCCCAGCCTGGAGAACAGCTCCCTCCAGAGATGACTGTGGCAAGATCTTCGGTCAAAGAGACCTCCAGAGAAGGCACCTCTTCCTTCCATACACGCCAGAAGTCTGAGGGTGGAGTGTATCATGACCCACACTCTGATGATGGCACAGCCCCCAAAGAAAATAGACACCTATACAATGACCCTGTGCCAAGGAGAGTTGGTAGCTTTTACAGAGTGCCATCTCCACGTCCAGACAATTCTTTCCATGAAAATAATGTGTCAACTAGAGTTTCTTCTCTACCATCAGAGAGCAGTTCTGGAACCAACCACTCAAAAAGACAACCAGCATTCGATCCATGGAAAAGTCCTGAAAATATTAGTCATTCAGAGCAACTCAAGGAAAAAGAGAAGCAAGGATTTTTCAGGTCAATGAAAAAGAAAAAGAAGAAATCTCAAACAGTACCCAATTCCGACAGCCCTGATCTTCTGACGTTGCAGAAATCCATTCATTCTGCTAGCACTCCAAGCAGCAGACCAAAGGAGTGGCGCCCCGAGAAGATCTCAGATCTGCAGACCCAAAGCCAGCCATTAAAATCACTGCGCAAGTTGTTACATCTCTCTTCGGCCTCAAATCACCCGGCTTCCTCAGATCCCCGCTTCCAGCCCTTAACAGCTCAACAAACCAAAAATTCCTTCTCAGAAATTCGGATTCACCCCCTGAGCCAGGCCTCTGGCGGGAGCAGCAACATCCGGCAGGAACCCGCACCGAAGGGCAGGCCAGCCCTCCAGCTGCCAGACGGTGGATGTGATGGCAGAAGACAGAGACACCATTCTGGACCCCAAGATAGACGCTTCATGTTAAGGACGACAGAACAACAAGGAGAATACTTCTGCTGTGGTGACCCAAAGAAGCCTCACACTCCGTGCGTCCCAAACCGAGCCCTTCATCGTCCAATCTCCAGTCCTGCTCCCTATCCAGTACTCCAGGTCCGAGGCACTTCCATGTGCCCGACACTCCAGGTCCGAGGCACTGATGCTTTCAGCTGCCCAACCCAGCAATCCGGGTTCTCTTTCTTCGTGAGACACGTTATGAGGGAAGCCCTGATTCACAGGGCCCAGGTAAACCAAGCTGCGCTCCTGACATACCATGAGAATGCGGCACTGACGGGCAAGTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQEN IVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEY VATRWYRSPELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILNSVLL DLMKNLLKLDPADRYLTEQCLNHPTFQTQRLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHRSNSKDIQNLSVGLPRADEGLPANESFLNGNL AGASLSPLHTKTYQASSQPGSTSKDLTNNNIPHLLSPKEAKSKTEFDFNIDPKPSEGPGTKYLKSNSRSQQNRHSFMESSQSKAGTLQPNEKQSRHSYID TIPQSSRSPSYRTKAKSHGALSDSKSVSNLSEARAQIAEPSTSRYFPSSCLDLNSPTSPTPTRHSDTRTLLSPSGRNNRNEGTLDSR*
Price: £125.00
Completion Time: 
7
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

CDKL5

cDNA Synonyms: 
EIEE2; ISSX; STK9
DU Number: 
DU67578
Cost of Production: 
200.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG CDKL5 R134*
Expressed: 
3Flag-CDKL5 R134*
Genbank: 
NM_003159.2 GI:83367066 with silent changes t996c and t2118c
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGAGTTGTACTTAAATGCAGACACAAGGAAACACATGAAATTGTGGCGATCAAGAAATTCAAGGACAGTGAAGAAAATGAAGAAGTCAAAGAAACGACTTTACGAGAGCTTAAAATGCTTCGGACTCTCAAGCAGGAAAACATTGTGGAGTTGAAGGAAGCATTTCGTCGGAGGGGAAAGTTGTACTTGGTGTTTGAGTATGTTGAAAAAAATATGCTCGAATTGCTGGAAGAAATGCCAAATGGAGTTCCACCTGAGAAAGTAAAAAGCTACATCTATCAGCTAATCAAGGCTATTCACTGGTGCCATAAGAATGATATTGTCCATTGAGATATAAAACCAGAAAATCTCTTAATCAGCCACAATGATGTCCTAAAACTGTGTGACTTTGGTTTTGCTCGTAATCTGTCAGAAGGCAATAATGCTAATTACACAGAGTACGTTGCCACCAGATGGTATCGGTCCCCAGAACTCTTACTTGGCGCTCCCTATGGAAAGTCCGTGGACATGTGGTCGGTGGGCTGTATTCTTGGGGAGCTTAGCGATGGACAGCCTTTATTTCCTGGAGAAAGTGAAATTGACCAACTTTTTACTATTCAGAAGGTGCTAGGACCACTTCCATCTGAGCAGATGAAGCTTTTCTACAGTAATCCTCGCTTCCATGGGCTCCGGTTTCCAGCTGTTAACCATCCTCAGTCCTTGGAAAGAAGATACCTTGGAATTTTGAATAGTGTTCTACTTGACCTAATGAAGAATTTACTGAAGTTGGACCCAGCTGACAGATACTTGACAGAACAGTGTTTGAATCACCCTACATTTCAAACCCAGAGACTTCTGGATCGTTCTCCTTCAAGGTCAGCAAAAAGAAAACCTTACCATGTGGAAAGCAGCACATTGTCTAATAGAAACCAAGCCGGCAAAAGCACTGCTTTGCAGTCTCACCACAGATCTAACAGCAAGGACATCCAGAACCTGAGTGTAGGCCTGCCCCGGGCTGACGAAGGTCTCCCTGCCAATGAAAGCTTCCTAAATGGAAACCTTGCTGGAGCTAGTCTTAGTCCACTGCACACCAAAACCTACCAAGCAAGCAGCCAGCCTGGGTCTACCAGCAAAGATCTCACCAACAACAACATACCACACCTTCTTAGCCCAAAAGAAGCCAAGTCAAAAACAGAGTTTGATTTTAATATTGACCCAAAGCCTTCAGAAGGCCCAGGGACAAAGTACCTCAAGTCAAACAGCAGATCTCAGCAGAACCGCCACTCATTCATGGAAAGCTCTCAAAGCAAAGCTGGGACACTGCAGCCCAATGAAAAGCAGAGTCGGCATAGCTATATTGACACAATTCCCCAGTCCTCTAGGAGTCCCTCCTACAGGACCAAGGCCAAAAGCCATGGGGCACTGAGTGACTCCAAGTCTGTGAGCAACCTTTCTGAAGCCAGGGCCCAAATTGCGGAGCCCAGTACCAGTAGGTACTTCCCATCTAGCTGCTTAGACTTGAATTCTCCCACCAGCCCAACCCCCACCAGACACAGTGACACGAGAACTTTGCTCAGCCCTTCTGGAAGAAATAACCGAAATGAGGGAACGCTGGACTCACGTCGAACCACAACCAGACATTCTAAGACGATGGAGGAATTGAAGCTGCCGGAGCACATGGACAGTAGCCATTCCCATTCACTGTCTGCACCTCACGAATCTTTTTCTTATGGACTGGGCTACACCAGCCCCTTTTCTTCCCAGCAACGTCCTCATAGGCATTCTATGTATGTGACCCGTGACAAAGTGAGAGCCAAGGGCTTGGATGGAAGCTTGAGCATAGGGCAAGGGATGGCAGCTAGAGCCAACAGCCTGCAACTCTTGTCACCCCAGCCTGGAGAACAGCTCCCTCCAGAGATGACTGTGGCAAGATCTTCGGTCAAAGAGACCTCCAGAGAAGGCACCTCTTCCTTCCATACACGCCAGAAGTCTGAGGGTGGAGTGTATCATGACCCACACTCTGATGATGGCACAGCCCCCAAAGAAAATAGACACCTATACAATGACCCTGTGCCAAGGAGAGTTGGTAGCTTTTACAGAGTGCCATCTCCACGTCCAGACAATTCTTTCCATGAAAATAATGTGTCAACTAGAGTTTCTTCTCTACCATCAGAGAGCAGTTCTGGAACCAACCACTCAAAAAGACAACCAGCATTCGATCCATGGAAAAGTCCTGAAAATATTAGTCATTCAGAGCAACTCAAGGAAAAAGAGAAGCAAGGATTTTTCAGGTCAATGAAAAAGAAAAAGAAGAAATCTCAAACAGTACCCAATTCCGACAGCCCTGATCTTCTGACGTTGCAGAAATCCATTCATTCTGCTAGCACTCCAAGCAGCAGACCAAAGGAGTGGCGCCCCGAGAAGATCTCAGATCTGCAGACCCAAAGCCAGCCATTAAAATCACTGCGCAAGTTGTTACATCTCTCTTCGGCCTCAAATCACCCGGCTTCCTCAGATCCCCGCTTCCAGCCCTTAACAGCTCAACAAACCAAAAATTCCTTCTCAGAAATTCGGATTCACCCCCTGAGCCAGGCCTCTGGCGGGAGCAGCAACATCCGGCAGGAACCCGCACCGAAGGGCAGGCCAGCCCTCCAGCTGCCAGACGGTGGATGTGATGGCAGAAGACAGAGACACCATTCTGGACCCCAAGATAGACGCTTCATGTTAAGGACGACAGAACAACAAGGAGAATACTTCTGCTGTGGTGACCCAAAGAAGCCTCACACTCCGTGCGTCCCAAACCGAGCCCTTCATCGTCCAATCTCCAGTCCTGCTCCCTATCCAGTACTCCAGGTCCGAGGCACTTCCATGTGCCCGACACTCCAGGTCCGAGGCACTGATGCTTTCAGCTGCCCAACCCAGCAATCCGGGTTCTCTTTCTTCGTGAGACACGTTATGAGGGAAGCCCTGATTCACAGGGCCCAGGTAAACCAAGCTGCGCTCCTGACATACCATGAGAATGCGGCACTGACGGGCAAGTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQEN IVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVH*
Price: £125.00
Completion Time: 
7
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

NEK1

cDNA Synonyms: 
NY-REN-55; SRPS2; SRPS2A; SRTD6
DU Number: 
DU67595
Cost of Production: 
120.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG NEK1 L760-E1286(end)
Expressed: 
3FLAG NEK1 L760-E1286(end)
Genbank: 
NM_001199397.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCCTCTCTGATACTTTTGAGATAAATGTTCATGAAGATGCCAAAGAGCATGAAAAAGAAAAATCAGTTTCATCTGATCGCAAGAAGTGGGAGGCAGGAGGTCAACTTGTGATTCCTCTGGATGAGTTAACACTAGATACATCCTTCTCTACAACTGAAAGACATACAGTGGGAGAAGTTATTAAATTAGGTCCTAATGGATCTCCAAGAAGAGCCTGGGGGAAAAGTCCGACAGATTCTGTTCTAAAGATACTTGGAGAAGCTGAACTACAACTTCAGACAGAACTATTAGAAAATACAACTATTAGAAGTGAGATTTCTCCCGAAGGGGAAAAGTACAAACCCTTAATTACTGGAGAAAAAAAAGTACAATGTATTTCACATGAAATAAACCCATCAGCTATTGTTGATTCTCCTGTTGAGACAAAAAGTCCCGAGTTCAGTGAGGCATCTCCACAGATGTCATTGAAACTGGAAGGAAATTTAGAAGAACCTGATGATTTGGAAACAGAAATTCTACAAGAGCCAAGTGGAACAAACAAAGATGAGAGCTTGCCATGCACTATTACTGATGTGTGGATTAGTGAGGAAAAAGAAACAAAGGAAACTCAGTCGGCAGATAGGATCACCATTCAGGAAAATGAAGTTTCTGAAGATGGAGTCTCGAGTACTGTGGACCAACTTAGTGACATTCATATAGAGCCTGGAACCAATGATTCTCAGCACTCTAAATGTGATGTAGATAAGTCTGTGCAACCGGAACCATTTTTCCATAAGGTGGTTCATTCTGAACACTTGAACTTAGTCCCTCAAGTTCAATCAGTTCAGTGTTCACCAGAAGAATCCTTTGCATTTCGATCTCACTCGCATTTACCACCAAAAAATAAAAACAAGAATTCCTTGCTGATTGGACTTTCAACTGGTCTGTTTGATGCAAACAACCCAAAGATGTTAAGGACATGTTCACTTCCAGATCTCTCAAAGCTGTTCAGAACCCTTATGGATGTTCCCACCGTAGGAGATGTTCGTCAAGACAATCTTGAAATAGATGAAATTGAAGATGAAAACATTAAAGAAGGACCTTCTGATTCTGAAGACATTGTGTTTGAAGAAACTGACACAGATTTACAAGAGCTGCAGGCCTCGATGGAACAGTTACTTAGGGAACAACCTGGTGAAGAATACAGTGAAGAAGAAGAGTCAGTCTTGAAGAACAGTGATGTGGAGCCAACTGCAAATGGGACAGATGTGGCAGATGAAGATGACAATCCCAGCAGTGAAAGTGCCCTGAACGAAGAATGGCACTCAGATAACAGTGATGGTGAAATTGCTAGTGAATGTGAATGCGATAGTGTCTTTAACCATTTAGAGGAACTGAGACTTCATCTGGAGCAGGAAATGGGCTTTGAAAAATTCTTTGAGGTTTATGAGAAAATAAAGGCTATTCATGAAGATGAAGATGAAAATATTGAAATTTGTTCAAAAATAGTTCAAAATATTTTGGGAAATGAACATCAGCATCTTTATGCCAAGATTCTTCATTTAGTCATGGCAGATGGAGCCTACCAAGAAGATAATGATGAATAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRA WGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKYKPLITGEKKVQCISHEINPSAIVDSPVETKSPEFSEASPQMSLKLEGNLEEPDDLETEI LQEPSGTNKDESLPCTITDVWISEEKETKETQSADRITIQENEVSEDGVSSTVDQLSDIHIEPGTNDSQHSKCDVDKSVQPEPFFHKVVHSEHLNLVPQV QSVQCSPEESFAFRSHSHLPPKNKNKNSLLIGLSTGLFDANNPKMLRTCSLPDLSKLFRTLMDVPTVGDVRQDNLEIDEIEDENIKEGPSDSEDIVFEET DTDLQELQASMEQLLREQPGEEYSEEEESVLKNSDVEPTANGTDVADEDDNPSSESALNEEWHSDNSDGEIASECECDSVFNHLEELRLHLEQEMGFEKF FEVYEKIKAIHEDEDENIEICSKIVQNILGNEHQHLYAKILHLVMADGAYQEDNDE*
Price: £125.00
Completion Time: 
8
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

NEK1

cDNA Synonyms: 
NY-REN-55; SRPS2; SRPS2A; SRTD6
DU Number: 
DU67594
Cost of Production: 
120.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG NEK1 D379-L760
Expressed: 
3FLAG NEK1 D379-L760
Genbank: 
NM_001199397.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCGATCAGATTATTAGTTTAATGAAGGCTGAACAAATGAAAAGGCAAGAAAAGGAAAGGTTGGAAAGAATAAATAGGGCCAGGGAACAAGGATGGAGAAATGTGCTAAGTGCTGGTGGAAGTGGTGAAGTAAAGGCTCCTTTTCTGGGCAGTGGAGGGACTATAGCTCCATCATCTTTTTCTTCTCGAGGACAGTATGAACATTACCATGCCATTTTTGACCAAATGCAGCAACAAAGAGCAGAAGATAATGAAGCTAAATGGAAAAGAGAAATATATGGTCGAGGTCTTCCAGAAAGAGGAATTCTGCCTGGAGTTCGTCCAGGATTTCCTTATGGGGCTGCAGGTCATCACCATTTTCCTGATGCTGATGATATTAGAAAAACTTTGAAAAGATTGAAGGCGGTGTCTAAACAAGCCAATGCAAACAGGCAAAAAGGGCAGCTAGCTGTAGAAAGAGCTAAACAAGTAGAAGAGTTCCTGCAGCGAAAACGGGAAGCTATGCAGAATAAAGCTCGAGCCGAAGGACATATGGGAATCCTGCAAAACCTGGCAGCTATGTATGGAGGCAGGCCCAGCTCTTCAAGAGGAGGGAAGCCAAGAAACAAAGAGGAAGAGGTTTATCTGGCAAGACTGAGGCAAATAAGACTACAGAATTTCAATGAGCGCCAACAGATTAAAGCCAAGCTTCGTGGTGAAAAGAAAGAAGCTAATCATTCTGAAGGACAAGAAGGAAGTGAAGAGGCTGACATGAGGCGCAAAAAAATCGAATCACTGAAGGCCCATGCAAATGCACGTGCTGCTGTACTAAAAGAACAACTAGAACGAAAGAGAAAGGAGGCTTATGAGAGAGAAAAAAAAGTGTGGGAAGAGCATTTGGTGGCTAAAGGAGTTAAGAGTTCTGATGTTTCTCCACCTTTGGGACAGCATGAAACAGGTGGCTCTCCATCAAAGCAACAGATGAGATCTGTTATTTCTGTAACTTCAGCTTTGAAAGAAGTTGGCGTGGACAGTAGTTTAACTGATACCCGGGAAACTTCAGAAGAGATGCAAAAGACCAACAATGCTATTTCAAGTAAGCGAGAAATACTTCGTAGATTAAATGAAAATCTTAAAGCTCAAGAAGATGAAAAAGGAAAGCAGAATCTCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSDQIISLMKAEQMKRQEKERLERINRAREQGWRNVLSAGGSGEVKAPFLGSGGTIAPSSFSSRGQYEHYHAI FDQMQQQRAEDNEAKWKREIYGRGLPERGILPGVRPGFPYGAAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQVEEFLQRKREAMQNKA RAEGHMGILQNLAAMYGGRPSSSRGGKPRNKEEEVYLARLRQIRLQNFNERQQIKAKLRGEKKEANHSEGQEGSEEADMRRKKIESLKAHANARAAVLKE QLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLK AQEDEKGKQNL*
Price: £125.00
Completion Time: 
8
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

NEK1

cDNA Synonyms: 
NY-REN-55; SRPS2; SRPS2A; SRTD6
DU Number: 
DU67593
Cost of Production: 
150.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG NEK1 M1-V1160
Expressed: 
3FLAG NEK1 M1-V1160
Genbank: 
NM_001199397.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGAGAAGTATGTTAGACTACAGAAGATTGGAGAAGGTTCATTTGGAAAAGCCATTCTTGTTAAATCTACAGAAGATGGCAGACAGTATGTTATCAAGGAAATTAACATCTCAAGAATGTCCAGTAAAGAAAGAGAAGAATCAAGGAGAGAAGTTGCAGTATTGGCAAACATGAAGCATCCAAATATTGTCCAGTATAGAGAATCATTTGAAGAAAATGGCTCTCTCTACATAGTAATGGATTACTGTGAGGGAGGGGATCTGTTTAAGCGAATAAATGCTCAGAAAGGCGTTTTGTTTCAAGAGGATCAGATTTTGGACTGGTTTGTACAGATATGTTTGGCCCTGAAACATGTACATGATAGAAAAATTCTTCATCGAGACATTAAATCTCAGAACATATTTTTAACTAAAGATGGAACAGTACAACTTGGAGATTTTGGAATTGCTAGAGTTCTTAATAGTACTGTAGAGCTGGCTCGAACTTGCATAGGGACCCCATACTACTTGTCACCTGAAATCTGTGAAAACAAACCTTACAATAATAAAAGTGACATTTGGGCTCTGGGGTGTGTCCTTTATGAGCTGTGTACACTTAAACATGCTTTTGAAGCTGGCAGTATGAAAAACCTGGTACTGAAGATAATATCTGGATCTTTTCCACCTGTGTCTTTGCATTATTCCTATGATCTCCGCAGTTTGGTGTCTCAGTTATTTAAAAGAAATCCTAGGGATAGACCATCAGTCAACTCCATATTGGAGAAAGGTTTTATAGCCAAACGCATTGAAAAGTTTCTCTCTCCTCAGCTTATTGCAGAAGAATTTTGTCTAAAAACATTTTCGAAGTTTGGATCACAGCCTATACCAGCTAAAAGACCAGCTTCAGGACAAAACTCGATTTCTGTTATGCCTGCTCAGAAAATTACAAAGCCTGCCGCTAAATATGGAATACCTTTAGCATATAAGAAATATGGAGATAAAAAATTACACGAAAAGAAACCACTGCAAAAACATAAACAGGCCCATCAAACTCCAGAGAAGAGAGTGAATACTGGAGAAGAAAGGAGGAAAATATCTGAGGAAGCAGCAAGAAAGAGAAGGCTGGAATTTATTGAAAAAGAAAAGAAACAAAAGGATCAGATTATTAGTTTAATGAAGGCTGAACAAATGAAAAGGCAAGAAAAGGAAAGGTTGGAAAGAATAAATAGGGCCAGGGAACAAGGATGGAGAAATGTGCTAAGTGCTGGTGGAAGTGGTGAAGTAAAGGCTCCTTTTCTGGGCAGTGGAGGGACTATAGCTCCATCATCTTTTTCTTCTCGAGGACAGTATGAACATTACCATGCCATTTTTGACCAAATGCAGCAACAAAGAGCAGAAGATAATGAAGCTAAATGGAAAAGAGAAATATATGGTCGAGGTCTTCCAGAAAGAGGAATTCTGCCTGGAGTTCGTCCAGGATTTCCTTATGGGGCTGCAGGTCATCACCATTTTCCTGATGCTGATGATATTAGAAAAACTTTGAAAAGATTGAAGGCGGTGTCTAAACAAGCCAATGCAAACAGGCAAAAAGGGCAGCTAGCTGTAGAAAGAGCTAAACAAGTAGAAGAGTTCCTGCAGCGAAAACGGGAAGCTATGCAGAATAAAGCTCGAGCCGAAGGACATATGGGAATCCTGCAAAACCTGGCAGCTATGTATGGAGGCAGGCCCAGCTCTTCAAGAGGAGGGAAGCCAAGAAACAAAGAGGAAGAGGTTTATCTGGCAAGACTGAGGCAAATAAGACTACAGAATTTCAATGAGCGCCAACAGATTAAAGCCAAGCTTCGTGGTGAAAAGAAAGAAGCTAATCATTCTGAAGGACAAGAAGGAAGTGAAGAGGCTGACATGAGGCGCAAAAAAATCGAATCACTGAAGGCCCATGCAAATGCACGTGCTGCTGTACTAAAAGAACAACTAGAACGAAAGAGAAAGGAGGCTTATGAGAGAGAAAAAAAAGTGTGGGAAGAGCATTTGGTGGCTAAAGGAGTTAAGAGTTCTGATGTTTCTCCACCTTTGGGACAGCATGAAACAGGTGGCTCTCCATCAAAGCAACAGATGAGATCTGTTATTTCTGTAACTTCAGCTTTGAAAGAAGTTGGCGTGGACAGTAGTTTAACTGATACCCGGGAAACTTCAGAAGAGATGCAAAAGACCAACAATGCTATTTCAAGTAAGCGAGAAATACTTCGTAGATTAAATGAAAATCTTAAAGCTCAAGAAGATGAAAAAGGAAAGCAGAATCTCTCTGATACTTTTGAGATAAATGTTCATGAAGATGCCAAAGAGCATGAAAAAGAAAAATCAGTTTCATCTGATCGCAAGAAGTGGGAGGCAGGAGGTCAACTTGTGATTCCTCTGGATGAGTTAACACTAGATACATCCTTCTCTACAACTGAAAGACATACAGTGGGAGAAGTTATTAAATTAGGTCCTAATGGATCTCCAAGAAGAGCCTGGGGGAAAAGTCCGACAGATTCTGTTCTAAAGATACTTGGAGAAGCTGAACTACAACTTCAGACAGAACTATTAGAAAATACAACTATTAGAAGTGAGATTTCTCCCGAAGGGGAAAAGTACAAACCCTTAATTACTGGAGAAAAAAAAGTACAATGTATTTCACATGAAATAAACCCATCAGCTATTGTTGATTCTCCTGTTGAGACAAAAAGTCCCGAGTTCAGTGAGGCATCTCCACAGATGTCATTGAAACTGGAAGGAAATTTAGAAGAACCTGATGATTTGGAAACAGAAATTCTACAAGAGCCAAGTGGAACAAACAAAGATGAGAGCTTGCCATGCACTATTACTGATGTGTGGATTAGTGAGGAAAAAGAAACAAAGGAAACTCAGTCGGCAGATAGGATCACCATTCAGGAAAATGAAGTTTCTGAAGATGGAGTCTCGAGTACTGTGGACCAACTTAGTGACATTCATATAGAGCCTGGAACCAATGATTCTCAGCACTCTAAATGTGATGTAGATAAGTCTGTGCAACCGGAACCATTTTTCCATAAGGTGGTTCATTCTGAACACTTGAACTTAGTCCCTCAAGTTCAATCAGTTCAGTGTTCACCAGAAGAATCCTTTGCATTTCGATCTCACTCGCATTTACCACCAAAAAATAAAAACAAGAATTCCTTGCTGATTGGACTTTCAACTGGTCTGTTTGATGCAAACAACCCAAAGATGTTAAGGACATGTTCACTTCCAGATCTCTCAAAGCTGTTCAGAACCCTTATGGATGTTCCCACCGTAGGAGATGTTCGTCAAGACAATCTTGAAATAGATGAAATTGAAGATGAAAACATTAAAGAAGGACCTTCTGATTCTGAAGACATTGTGTTTGAAGAAACTGACACAGATTTACAAGAGCTGCAGGCCTCGATGGAACAGTTACTTAGGGAACAACCTGGTGAAGAATACAGTGAAGAAGAAGAGTCAGTCTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFE ENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLS PEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQLI AEEFCLKTFSKFGSQPIPAKRPASGQNSISVMPAQKITKPAAKYGIPLAYKKYGDKKLHEKKPLQKHKQAHQTPEKRVNTGEERRKISEEAARKRRLEFI EKEKKQKDQIISLMKAEQMKRQEKERLERINRAREQGWRNVLSAGGSGEVKAPFLGSGGTIAPSSFSSRGQYEHYHAIFDQMQQQRAEDNEAKWKREIYG RGLPERGILPGVRPGFPYGAAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQVEEFLQRKREAMQNKARAEGHMGILQNLAAMYGGRPSS SRGGKPRNKEEEVYLARLRQIRLQNFNERQQIKAKLRGEKKEANHSEGQEGSEEADMRRKKIESLKAHANARAAVLKEQLERKRKEAYEREKKVWEEHLV AKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHED AKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKY KPLITGEKKVQCISHEINPSAIVDSPVETKSPEFSEASPQMSLKLEGNLEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRITIQE NEVSEDGVSSTVDQLSDIHIEPGTNDSQHSKCDVDKSVQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSHLPPKNKNKNSLLIGLSTGLFDAN NPKMLRTCSLPDLSKLFRTLMDVPTVGDVRQDNLEIDEIEDENIKEGPSDSEDIVFEETDTDLQELQASMEQLLREQPGEEYSEEEESV*
Price: £125.00
Completion Time: 
8
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

NEK1

cDNA Synonyms: 
NY-REN-55; SRPS2; SRPS2A; SRTD6
DU Number: 
DU67501
Cost of Production: 
120.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG NEK1 N732-I1258
Expressed: 
3FLAG NEK1 N732-I1258
Genbank: 
NM_001199397.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCAATGCTATTTCAAGTAAGCGAGAAATACTTCGTAGATTAAATGAAAATCTTAAAGCTCAAGAAGATGAAAAAGGAAAGCAGAATCTCTCTGATACTTTTGAGATAAATGTTCATGAAGATGCCAAAGAGCATGAAAAAGAAAAATCAGTTTCATCTGATCGCAAGAAGTGGGAGGCAGGAGGTCAACTTGTGATTCCTCTGGATGAGTTAACACTAGATACATCCTTCTCTACAACTGAAAGACATACAGTGGGAGAAGTTATTAAATTAGGTCCTAATGGATCTCCAAGAAGAGCCTGGGGGAAAAGTCCGACAGATTCTGTTCTAAAGATACTTGGAGAAGCTGAACTACAACTTCAGACAGAACTATTAGAAAATACAACTATTAGAAGTGAGATTTCTCCCGAAGGGGAAAAGTACAAACCCTTAATTACTGGAGAAAAAAAAGTACAATGTATTTCACATGAAATAAACCCATCAGCTATTGTTGATTCTCCTGTTGAGACAAAAAGTCCCGAGTTCAGTGAGGCATCTCCACAGATGTCATTGAAACTGGAAGGAAATTTAGAAGAACCTGATGATTTGGAAACAGAAATTCTACAAGAGCCAAGTGGAACAAACAAAGATGAGAGCTTGCCATGCACTATTACTGATGTGTGGATTAGTGAGGAAAAAGAAACAAAGGAAACTCAGTCGGCAGATAGGATCACCATTCAGGAAAATGAAGTTTCTGAAGATGGAGTCTCGAGTACTGTGGACCAACTTAGTGACATTCATATAGAGCCTGGAACCAATGATTCTCAGCACTCTAAATGTGATGTAGATAAGTCTGTGCAACCGGAACCATTTTTCCATAAGGTGGTTCATTCTGAACACTTGAACTTAGTCCCTCAAGTTCAATCAGTTCAGTGTTCACCAGAAGAATCCTTTGCATTTCGATCTCACTCGCATTTACCACCAAAAAATAAAAACAAGAATTCCTTGCTGATTGGACTTTCAACTGGTCTGTTTGATGCAAACAACCCAAAGATGTTAAGGACATGTTCACTTCCAGATCTCTCAAAGCTGTTCAGAACCCTTATGGATGTTCCCACCGTAGGAGATGTTCGTCAAGACAATCTTGAAATAGATGAAATTGAAGATGAAAACATTAAAGAAGGACCTTCTGATTCTGAAGACATTGTGTTTGAAGAAACTGACACAGATTTACAAGAGCTGCAGGCCTCGATGGAACAGTTACTTAGGGAACAACCTGGTGAAGAATACAGTGAAGAAGAAGAGTCAGTCTTGAAGAACAGTGATGTGGAGCCAACTGCAAATGGGACAGATGTGGCAGATGAAGATGACAATCCCAGCAGTGAAAGTGCCCTGAACGAAGAATGGCACTCAGATAACAGTGATGGTGAAATTGCTAGTGAATGTGAATGCGATAGTGTCTTTAACCATTTAGAGGAACTGAGACTTCATCTGGAGCAGGAAATGGGCTTTGAAAAATTCTTTGAGGTTTATGAGAAAATAAAGGCTATTCATGAAGATGAAGATGAAAATATTGAAATTTGTTCAAAAATAGTTCAAAATATTTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELT LDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKYKPLITGEKKVQCISHEINPSAIVDSPVETKS PEFSEASPQMSLKLEGNLEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRITIQENEVSEDGVSSTVDQLSDIHIEPGTNDSQHSK CDVDKSVQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSHLPPKNKNKNSLLIGLSTGLFDANNPKMLRTCSLPDLSKLFRTLMDVPTVGDVRQ DNLEIDEIEDENIKEGPSDSEDIVFEETDTDLQELQASMEQLLREQPGEEYSEEEESVLKNSDVEPTANGTDVADEDDNPSSESALNEEWHSDNSDGEIA SECECDSVFNHLEELRLHLEQEMGFEKFFEVYEKIKAIHEDEDENIEICSKIVQNI*
Price: £125.00
Completion Time: 
8
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

NEK1

cDNA Synonyms: 
NY-REN-55; SRPS2; SRPS2A; SRTD6
DU Number: 
DU67495
Cost of Production: 
80.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG NEK1 D379-N732
Expressed: 
3FLAG NEK1 D379-N732
Genbank: 
NM_001199397.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCGATCAGATTATTAGTTTAATGAAGGCTGAACAAATGAAAAGGCAAGAAAAGGAAAGGTTGGAAAGAATAAATAGGGCCAGGGAACAAGGATGGAGAAATGTGCTAAGTGCTGGTGGAAGTGGTGAAGTAAAGGCTCCTTTTCTGGGCAGTGGAGGGACTATAGCTCCATCATCTTTTTCTTCTCGAGGACAGTATGAACATTACCATGCCATTTTTGACCAAATGCAGCAACAAAGAGCAGAAGATAATGAAGCTAAATGGAAAAGAGAAATATATGGTCGAGGTCTTCCAGAAAGAGGAATTCTGCCTGGAGTTCGTCCAGGATTTCCTTATGGGGCTGCAGGTCATCACCATTTTCCTGATGCTGATGATATTAGAAAAACTTTGAAAAGATTGAAGGCGGTGTCTAAACAAGCCAATGCAAACAGGCAAAAAGGGCAGCTAGCTGTAGAAAGAGCTAAACAAGTAGAAGAGTTCCTGCAGCGAAAACGGGAAGCTATGCAGAATAAAGCTCGAGCCGAAGGACATATGGGAATCCTGCAAAACCTGGCAGCTATGTATGGAGGCAGGCCCAGCTCTTCAAGAGGAGGGAAGCCAAGAAACAAAGAGGAAGAGGTTTATCTGGCAAGACTGAGGCAAATAAGACTACAGAATTTCAATGAGCGCCAACAGATTAAAGCCAAGCTTCGTGGTGAAAAGAAAGAAGCTAATCATTCTGAAGGACAAGAAGGAAGTGAAGAGGCTGACATGAGGCGCAAAAAAATCGAATCACTGAAGGCCCATGCAAATGCACGTGCTGCTGTACTAAAAGAACAACTAGAACGAAAGAGAAAGGAGGCTTATGAGAGAGAAAAAAAAGTGTGGGAAGAGCATTTGGTGGCTAAAGGAGTTAAGAGTTCTGATGTTTCTCCACCTTTGGGACAGCATGAAACAGGTGGCTCTCCATCAAAGCAACAGATGAGATCTGTTATTTCTGTAACTTCAGCTTTGAAAGAAGTTGGCGTGGACAGTAGTTTAACTGATACCCGGGAAACTTCAGAAGAGATGCAAAAGACCAACAATTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSDQIISLMKAEQMKRQEKERLERINRAREQGWRNVLSAGGSGEVKAPFLGSGGTIAPSSFSSRGQYEHYHAI FDQMQQQRAEDNEAKWKREIYGRGLPERGILPGVRPGFPYGAAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQVEEFLQRKREAMQNKA RAEGHMGILQNLAAMYGGRPSSSRGGKPRNKEEEVYLARLRQIRLQNFNERQQIKAKLRGEKKEANHSEGQEGSEEADMRRKKIESLKAHANARAAVLKE QLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNN*
Price: £125.00
Completion Time: 
8
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

NEK1

cDNA Synonyms: 
NY-REN-55; SRPS2; SRPS2A; SRTD6
DU Number: 
DU67494
Cost of Production: 
80.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG NEK1 M1-D379
Expressed: 
3FLAG NEK1 M1-D379
Genbank: 
NM_001199397.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGAGAAGTATGTTAGACTACAGAAGATTGGAGAAGGTTCATTTGGAAAAGCCATTCTTGTTAAATCTACAGAAGATGGCAGACAGTATGTTATCAAGGAAATTAACATCTCAAGAATGTCCAGTAAAGAAAGAGAAGAATCAAGGAGAGAAGTTGCAGTATTGGCAAACATGAAGCATCCAAATATTGTCCAGTATAGAGAATCATTTGAAGAAAATGGCTCTCTCTACATAGTAATGGATTACTGTGAGGGAGGGGATCTGTTTAAGCGAATAAATGCTCAGAAAGGCGTTTTGTTTCAAGAGGATCAGATTTTGGACTGGTTTGTACAGATATGTTTGGCCCTGAAACATGTACATGATAGAAAAATTCTTCATCGAGACATTAAATCTCAGAACATATTTTTAACTAAAGATGGAACAGTACAACTTGGAGATTTTGGAATTGCTAGAGTTCTTAATAGTACTGTAGAGCTGGCTCGAACTTGCATAGGGACCCCATACTACTTGTCACCTGAAATCTGTGAAAACAAACCTTACAATAATAAAAGTGACATTTGGGCTCTGGGGTGTGTCCTTTATGAGCTGTGTACACTTAAACATGCTTTTGAAGCTGGCAGTATGAAAAACCTGGTACTGAAGATAATATCTGGATCTTTTCCACCTGTGTCTTTGCATTATTCCTATGATCTCCGCAGTTTGGTGTCTCAGTTATTTAAAAGAAATCCTAGGGATAGACCATCAGTCAACTCCATATTGGAGAAAGGTTTTATAGCCAAACGCATTGAAAAGTTTCTCTCTCCTCAGCTTATTGCAGAAGAATTTTGTCTAAAAACATTTTCGAAGTTTGGATCACAGCCTATACCAGCTAAAAGACCAGCTTCAGGACAAAACTCGATTTCTGTTATGCCTGCTCAGAAAATTACAAAGCCTGCCGCTAAATATGGAATACCTTTAGCATATAAGAAATATGGAGATAAAAAATTACACGAAAAGAAACCACTGCAAAAACATAAACAGGCCCATCAAACTCCAGAGAAGAGAGTGAATACTGGAGAAGAAAGGAGGAAAATATCTGAGGAAGCAGCAAGAAAGAGAAGGCTGGAATTTATTGAAAAAGAAAAGAAACAAAAGGATTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFE ENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLS PEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQLI AEEFCLKTFSKFGSQPIPAKRPASGQNSISVMPAQKITKPAAKYGIPLAYKKYGDKKLHEKKPLQKHKQAHQTPEKRVNTGEERRKISEEAARKRRLEFI EKEKKQKD*
Price: £125.00
Completion Time: 
8
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

USP2

cDNA Synonyms: 
USP9; UBP41
DU Number: 
DU61200
Cost of Production: 
100.00
Plasmid: 
pCAGGS puro 3FLAG USP2
Expressed: 
3FLAG USP2
Genbank: 
NM_004205.5
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKMSQLSSTLKRYTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSSLLDYDRG RPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRK ELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETGKGQAPGPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCF MNSILQCLSNTRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVT LRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCC RCRGRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSS VTPMSSSQVRTSDAYLLFYELASPPSRM*
Price: £125.00
Completion Time: 
16
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
Ubiquitylation Site: 
Yes

USP29

cDNA Synonyms: 
HOM-TES-84/86
DU Number: 
DU61201
Cost of Production: 
100.00
Plasmid: 
pCAGGS puro 3FLAG USP29
Expressed: 
3FLAG USP29
Genbank: 
NM_020903.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKMISLKVCGFIQIWSQKTGMTKLKEALIETVQRQKEIKLVVTFKSGKFIRIFQLSNNIRSVVLRHCKKRQSHLRLTLK NNVFLFIDKLSYRDAKQLNMFLDIIHQNKSQQPMKSDDDWSVFESRNMLKEIDKTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDV QTNEDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDETVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLD SHSQQLQQGFPNLGNTCYMNAVLQSLFAIPSFADDLLTQGVPWEYIPFEALIMTLTQLLALKDFCSTKIKRELLGNVKKVISAVAEIFSGNMQNDAHEFL GQCLDQLKEDMEKLNATLNTGKECGDENSSPQMHVGSAATKVFVCPVVANFEFELQLSLICKACGHAVLKVEPNNYLSINLHQETKPLPLSIQNSLDLFF KEEELEYNCQMCKQKSCVARHTFSRLSRVLIIHLKRYSFNNAWLLVKNNEQVYIPKSLSLSSYCNESTKPPLPLSSSAPVGKCEVLEVSQEMISEINSPL TPSMKLTSESSDSLVLPVEPDKNADLQRFQRDCGDASQEQHQRDLENGSALESELVHFRDRAIGEKELPVADSLMDQGDISLPVMYEDGGKLISSPDTRL VEVHLQEVPQHPELQKYEKTNTFVEFNFDSVTESTNGFYDCKENRIPEGSQGMAEQLQQCIEESIIDEFLQQAPPPGVRKLDAQEHTEETLNQSTELRLQ KADLNHLGALGSDNPGNKNILDAENTRGEAKELTRNVKMGDPLQAYRLISVVSHIGSSPNSGHYISDVYDFQKQAWFTYNDLCVSEISETKMQEARLHSG YIFFYMHNGIFEELLRKAENSRLPSTQAGVIPQGEYEGDSLYRPA*
Price: £125.00
Completion Time: 
16
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
Ubiquitylation Site: 
Yes

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.