3FLAG

Srpk2 (mouse)

cDNA Synonyms: 
Wbp6; mSRPK2; AW226533; AW492537; AW547358
DU Number: 
DU61764
Plasmid: 
pCAGGS puro 3FLAG mouse Srpk2 (internal BamH1 killed)
Expressed: 
3FLAG mouse Srpk2 (internal BamH1 killed)
Genbank: 
GI: 20817, NP_033300.2 with delta Q314 - common variant, and some silent changes
Species: 
Mouse
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGSPEFNSSMSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPLPDPAPPEPEEEILGSDDEEQEDPADYCKGGYHPV KIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGH HLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKK LKKKQKRQAELLEKRLQEIEELEREAERKILEENITSAEASGEQDGEYQPEVTLKAADLEDTTEEETAKDNGEVEDQEEKEDAEKENAEKDEDDVEQELA NLDPTWVESPKANGHIENGPFSLEQQLEDEEDDEDDCANPEEYNLDEPNAESDYTYSSSYEQFNGELPNGQHKTSEFPTPLFSGPLEPVACGSVISEGSP LTEQEESSPSHDRSRTVSASSTGDLPKTKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFE LATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRAS AGECLRHPWLNS*
Price: £125.00
Completion Time: 
0
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

RAD54L

cDNA Synonyms: 
hHR54; HR54; hRAD54; RAD54A
DU Number: 
DU70556
Cost of Production: 
120.00
Plasmid: 
pcDNA5 FRT TO 3FLAG RAD54L S572A
Expressed: 
3FLAG RAD54L S572A
Genbank: 
NM_003579.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
gCGGCCGCtatgaggaggagcttggctcccagccagctggccaagagaaaacctgaaggcaggtcctgtgatgatgaagactggcaacctggcctagtgactcctaggaaacggaaatccagcagtgagacccagatccaggagtgtttcctgtctccttttcggaaacctttgagtcagctaaccaatcaaccaccttgtctggacagcagtcagcatgaagcatttattcgaagcattttgtcaaagcctttcaaagtccccattccaaattatcaaggtcctctgggctctcgagcattgggcctgaaaagggctggggtccgccgggccctccatgaccccctggaaaaagatgccttggttctgtatgagcctcccccgctgagcgctcatgaccagctgaagcttgacaaggagaaactccctgtccatgtggttgttgaccctattctcagtaaggttttgcggcctcatcagagagagggagtgaaattcctgtgggagtgtgtcaccagtcggcgcatccctggcagccatggctgcatcatggctgatgagatgggcctaggaaagacgctgcagtgcatcacattgatgtggacacttttacgccagagtccagagtgcaagccagaaattgacaaggcagtggtggtgtcgccttccagcctggtgaagaactggtacaatgaggttgggaaatggctcggagggaggatccaacctctggccatcgatggaggatctaaggatgaaatagaccaaaagctggaaggattcatgaaccagcgtggagccagggtgtcttctcccatcctcatcatttcctatgagaccttccgccttcatgttggagtcctccagaaaggaagtgttggtctggtcatatgtgacgagggacacaggctcaagaactctgagaatcagacttaccaagccctggacagcttgaacaccagccggcgggtgctcatctccggaactcccatccagaatgatctgcttgagtatttcagcttggtacattttgttaattccggcatcctagggactgcccatgaattcaagaagcattttgaattgccaattttgaagggtcgagacgctgctgctagtgaggcagacaggcagctaggagaggagcggctgcgggagctcaccagcattgtgaatagatgcctgatacggaggacttctgatatcctttctaaatatctgcctgtgaagattgagcaggtcgtttgttgtaggctgacaccccttcagactgagttatacaagaggtttctgagacaagccaaaccggcagaagaattgcttgagggcaagatgagtgtgtcttccctttcttccatcacctcgctaaagaagctttgtaatcatccagctctaatctatgataagtgtgtggaagaggaggatggctttgtgggtgccttggacctcttccctcctggttacagctctaaggccctggagccccagctgtcaggtaagatgctggtcctggattatattctggcggtgacccgaagccgtagcagtgacaaagtagtgctggtgtcgaattacacccagactttggatctctttgagaagctgtgccgtgcccgaaggtacttatacgtccgcctggatggcacgatgtccattaagaagcgagccaaggttgtagaacgcttcaatagtccatcgagccctgactttgtcttcatgctggccagcaaagctgggggctgtggcctcaatctcattggggctaaccggctggtcatgtttgaccctgactggaacccagccaatgatgaacaagccatggcccgggtctggcgagatggtcaaaagaagacttgctatatctaccgcctgctgtctgcagggaccattgaggagaagatcttccagcgtcagagccacaagaaggcactgagcagctgtgtggtggatgaggagcaggatgtagagcgccacttctctctgggcgagttgaaggagctgtttatcctggatgaagctagcctcagtgacacacatgacaggttgcactgccgacgttgtgtcaacagccgtcagatccggccaccccctgatggttctgactgcacttcagacctggcagggtggaaccactgcactgataagtgggggctccgggatgaggtactccaggctgcctgggatgctgcctccactgctatcaccttcgtcttccaccagcgttctcatgaggagcagcggggcctccgctgagcggccgc
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSPEFPGRLEAAAMRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTN QPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLPVHVVVDPILSKVLRPHQREG VKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCITLMWTLLRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMN QRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELP ILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHP ALIYDKCVEEEDGFVGALDLFPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFN SPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGE LKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR*
Price: £125.00
Completion Time: 
18
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No

RAD54L

cDNA Synonyms: 
hHR54; HR54; hRAD54; RAD54A
DU Number: 
DU70548
Cost of Production: 
120.00
Plasmid: 
pcDNA5 FRT TO 3FLAG RAD54L
Expressed: 
3FLAG RAD54L
Genbank: 
NM_003579.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
gCGGCCGCtatgaggaggagcttggctcccagccagctggccaagagaaaacctgaaggcaggtcctgtgatgatgaagactggcaacctggcctagtgactcctaggaaacggaaatccagcagtgagacccagatccaggagtgtttcctgtctccttttcggaaacctttgagtcagctaaccaatcaaccaccttgtctggacagcagtcagcatgaagcatttattcgaagcattttgtcaaagcctttcaaagtccccattccaaattatcaaggtcctctgggctctcgagcattgggcctgaaaagggctggggtccgccgggccctccatgaccccctggaaaaagatgccttggttctgtatgagcctcccccgctgagcgctcatgaccagctgaagcttgacaaggagaaactccctgtccatgtggttgttgaccctattctcagtaaggttttgcggcctcatcagagagagggagtgaaattcctgtgggagtgtgtcaccagtcggcgcatccctggcagccatggctgcatcatggctgatgagatgggcctaggaaagacgctgcagtgcatcacattgatgtggacacttttacgccagagtccagagtgcaagccagaaattgacaaggcagtggtggtgtcgccttccagcctggtgaagaactggtacaatgaggttgggaaatggctcggagggaggatccaacctctggccatcgatggaggatctaaggatgaaatagaccaaaagctggaaggattcatgaaccagcgtggagccagggtgtcttctcccatcctcatcatttcctatgagaccttccgccttcatgttggagtcctccagaaaggaagtgttggtctggtcatatgtgacgagggacacaggctcaagaactctgagaatcagacttaccaagccctggacagcttgaacaccagccggcgggtgctcatctccggaactcccatccagaatgatctgcttgagtatttcagcttggtacattttgttaattccggcatcctagggactgcccatgaattcaagaagcattttgaattgccaattttgaagggtcgagacgctgctgctagtgaggcagacaggcagctaggagaggagcggctgcgggagctcaccagcattgtgaatagatgcctgatacggaggacttctgatatcctttctaaatatctgcctgtgaagattgagcaggtcgtttgttgtaggctgacaccccttcagactgagttatacaagaggtttctgagacaagccaaaccggcagaagaattgcttgagggcaagatgagtgtgtcttccctttcttccatcacctcgctaaagaagctttgtaatcatccagctctaatctatgataagtgtgtggaagaggaggatggctttgtgggtgccttggacctcttccctcctggttacagctctaaggccctggagccccagctgtcaggtaagatgctggtcctggattatattctggcggtgacccgaagccgtagcagtgacaaagtagtgctggtgtcgaattacacccagactttggatctctttgagaagctgtgccgtgcccgaaggtacttatacgtccgcctggatggcacgatgtccattaagaagcgagccaaggttgtagaacgcttcaatagtccatcgagccctgactttgtcttcatgctgagcagcaaagctgggggctgtggcctcaatctcattggggctaaccggctggtcatgtttgaccctgactggaacccagccaatgatgaacaagccatggcccgggtctggcgagatggtcaaaagaagacttgctatatctaccgcctgctgtctgcagggaccattgaggagaagatcttccagcgtcagagccacaagaaggcactgagcagctgtgtggtggatgaggagcaggatgtagagcgccacttctctctgggcgagttgaaggagctgtttatcctggatgaagctagcctcagtgacacacatgacaggttgcactgccgacgttgtgtcaacagccgtcagatccggccaccccctgatggttctgactgcacttcagacctggcagggtggaaccactgcactgataagtgggggctccgggatgaggtactccaggctgcctgggatgctgcctccactgctatcaccttcgtcttccaccagcgttctcatgaggagcagcggggcctccgctgagGTGcggccgc
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSPEFPGRLEAAAMRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTN QPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLPVHVVVDPILSKVLRPHQREG VKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCITLMWTLLRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMN QRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELP ILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHP ALIYDKCVEEEDGFVGALDLFPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFN SPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGE LKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR*
Price: £125.00
Completion Time: 
18
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No

Vector

DU Number: 
DU70412
Plasmid: 
pBabeD Hygro C-3FLAG
Genbank: 
-
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
see snapgene file
Amino Acid Sequence: 
see snapgene file
Price: £125.00
Completion Time: 
0
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No

Vector

DU Number: 
DU67927
Cost of Production: 
80.00
Plasmid: 
pBabeD puro 3HA
Genbank: 
-
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
See snapgene file
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
30
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No

ELOA

cDNA Synonyms: 
TCEB3; SIII; SIII p110; TCEB3; TCEB3A; Elongin A
DU Number: 
DU67870
Cost of Production: 
100.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG ELOA S311A
Expressed: 
3FLAG ELOA S311A
Genbank: 
NM_003198.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGCACGGAGGGCGGAGCTGCGGCCCGAGGACGCGACGCGAGCCCAGTTCCGGCGAGGAGGCCGCGCCAGTGACAGCGATGGCGGCGGAGTCGG CGCTCCAAGTTGTGGAGAAGCTGCAGGCGCGCCTGGCCGCGAACCCGGACCCTAAGAAGCTATTGAAATATTTGAAGAAACTCTCCACCCTGCCTATTAC AGTAGACATTCTTGCGGAGACTGGGGTTGGGAAAACAGTAAATAGCTTGCGAAAACACGAGCATGTTGGAAGCTTTGCCAGGGACCTAGTGGCCCAGTGG AAGAAGCTGGTTCCTGTGGAACGAAATGCTGAGCCTGATGAACAGGACTTTGAGAAGAGCAATTCCCGAAAGCGCCCTCGGGATGCCCTGCAGAAGGAGG AGGAGATGGAGGGGGACTACCAAGAAACCTGGAAAGCCACGGGGAGCCGATCCTATAGCCCTGACCACAGGCAGAAGAAACATAGGAAACTCTCGGAGCT CGAGAGACCTCACAAAGTGTCTCACGGTCATGAGAGGAGAGATGAGAGAAAGAGGTGTCACAGAATGTCACCAACTTACTCTTCAGACCCTGAGTCTTCT GATTATGGCCATGTTCAATCCCCTCCATCTTGTACCAGTCCTCATCAGATGTACGTCGACCACTACAGATCCCTGGAGGAGGACCAGGAGCCCATTGTTT CACACCAGAAGCCTGGGAAAGGCCACAGCAATGCCTTTCAGGACAGACTCGGGGCCAGCCAAGAACGACACCTGGGTGAACCCCATGGGAAAGGGGTTGT GAGTCAAAACAAGGAGCACAAATCTTCCCACAAGGACAAACGCCCCGTGGATGCCAAGAGTGATGAGAAGGCCTCTGTGGTGAGCAGAGAGAAATCACAC AAGGCCCTCTCCAAAGAGGAGAACCGAAGGCCACCCGCAGGGGACAATGCAAGGGAGAAACCGCCCTCTAGTGGCGTAAAGAAAGAGAAGGACAGAGAGG GCAGCAGCCTGAAGAAGAAGTGTTTGCCTCCCTCAGAGGCCGCTTCAGACAACCACCTGAAAAAGCCAAAGCACAGAGACCCAGAGAAAGCCAAATTGGA CAAAAGCAAGCAAGGTCTGGACAGCTTTGACACAGGAAAAGGAGCAGGAGACCTGTTGCCCAAGGTAAAAGAGAAGGGTTCTAACAACCTAAAGACTCCA GAAGGGAAAGTCAAAACTAATTTGGATAGAAAGTCACTGGGCTCCCTCCCTAAAGTTGAGGAGACAGATATGGAGGATGAATTCGAGCAGCCAACCATGT CTTTTGAATCCTACCTCAGCTATGACCAGCCCCGGAAGAAAAAGAAAAAGATTGTGAAAACTTCAGCCACGGCACTTGGAGATAAAGGACTTAAAAAAAA TGACTCTAAAAGCACTGGTAAAAACTTGGACTCAGTTCAGAAATTACCCAAGGTGAACAAAACCAAGTCAGAGAAGCCGGCTGGAGCTGATTTAGCCAAG CTGAGAAAGGTGCCTGATGTGTTGCCAGTGTTGCCAGACCTCCCGTTACCCGCGATACAGGCCAATTACCGTCCACTGCCTTCCCTCGAGCTGATATCCT CCTTCCAGCCAAAGCGAAAAGCGTTCTCTTCACCCCAGGAAGAAGAAGAAGCTGGATTTACTGGGCGCAGAATGAATTCCAAGATGCAGGTGTATTCTGG TTCCAAGTGTGCCTATCTCCCTAAAATGATGACCTTGCACCAGCAATGCATCCGAGTACTTAAAAACAACATCGATTCAATCTTTGAAGTGGGAGGAGTC CCATACTCTGTTCTTGAACCCGTTTTGGAGAGGTGTACACCTGATCAGCTGTATCGCATAGAGGAATACAATCATGTATTAATTGAAGAAACAGATCAAT TATGGAAAGTTCATTGTCACCGAGACTTTAAGGAAGAAAGACCCGAAGAGTATGAGTCGTGGCGAGAGATGTACCTGCGGCTTCAGGACGCCCGAGAGCA GCGGCTACGAGTACTAACAAAGAATATCCAGTTCGCACATGCCAATAAGCCCAAAGGCCGACAAGCAAAGATGGCCTTTGTCAACTCTGTGGCCAAGCCA CCTCGTGACGTCCGGAGGAGGCAGGAAAAGTTTGGAACGGGAGGAGCAGCTGTCCCTGAGAAAATCAAGATCAAGCCAGCCCCGTACCCCATGGGAAGCA GCCATGCTTCCGCCAGTAGCATCAGCTTTAACCCCAGCCCTGAGGAGCCGGCCTATGATGGCCCAAGCACCAGCAGTGCCCACTTGGCACCAGTGGTCAG CAGCACTGTTTCCTATGATCCTAGGAAACCCACTGTGAAGAAAATTGCCCCAATGATGGCCAAGACAATTAAAGCTTTCAAGAACAGATTCTCCCGACGA TAAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMHGGRSCGPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLAANPDPKKLLKYLKKLSTLPITVDILAE TGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKV SHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMYVDHYRSLEEDQEPIVSHQKPGKGHSNAFQDRLGASQERHLGEPHGKGVVSQNKEH KSSHKDKRPVDAKSDEKASVVSREKSHKALSKEENRRPPAGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPEKAKLDKSKQGL DSFDTGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEETDMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTG KNLDSVQKLPKVNKTKSEKPAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAFSSPQEEEEAGFTGRRMNSKMQVYSGSKCAYL PKMMTLHQQCIRVLKNNIDSIFEVGGVPYSVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKEERPEEYESWREMYLRLQDAREQRLRVLT KNIQFAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKIKIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSYD PRKPTVKKIAPMMAKTIKAFKNRFSRR*
Price: £125.00
Completion Time: 
14
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
PMID: 
rouse-CDKL5-paper-3
COVID-19: 
No

CDKL5 (mouse)

cDNA Synonyms: 
BC038161; Stk9
DU Number: 
DU67623
Cost of Production: 
100.00
Plasmid: 
pBabeD puro 3FLAG mouse CDKL5 NLS
Expressed: 
3FLAG mouse CDKL5 NLS
Genbank: 
NM_001024624.2
Species: 
Mouse
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTCGGTGAAGGAGCCTATGGAGTTGTACTTAAATGCAGACACAAGGAAACACATGAAATTGTGGCAATCAAGAAATTCAAGGACAGCGAAGAAAATGAAGAAGTCAAGGAGACGACCTTACGAGAGCTTAAAATGCTTCGCACTCTCAAGCAGGAAAACATTGTGGAGCTGAAGGAAGCTTTTCGTCGGAGAGGAAAATTATACCTGGTGTTTGAATATGTTGAGAAGAATATGCTTGAATTGCTGGAAGAAATGCCAAATGGAGTTCCACCTGAAAAAGTCAAGAGCTATATCTACCAACTAATCAAAGCTATCCACTGGTGCCACAAGAACGACATCGTCCACAGAGATATAAAGCCTGAAAATCTCTTAATCAGCCACAATGATGTCCTGAAACTATGTGACTTTGGTTTTGCTCGCAATCTCTCAGAGGGCAATAATGCTAATTATACAGAGTATGTGGCTACAAGGTGGTACCGATCCCCAGAACTGCTACTTGGAGCCCCCTATGGAAAGTCAGTGGACATGTGGTCAGTGGGCTGTATTCTTGGAGAGCTTAGTGATGGCCAGCCCTTATTTCCTGGAGAAAGTGAAATTGACCAACTCTTTACTATTCAGAAGGTGCTAGGACCACTTCCATCTGAGCAAATGAAGCTCTTCTACAGTAACCCTCGTTTCCATGGGCTCCGGTTCCCAGCTGTTAACCATCCTCAGTCATTAGAGAGAAGATACCTTGGAATTTTAAATAGTGTTTTACTTGACCTAATGAAGAATTTACTGAAGTTGGACCCAGCTGACAGATACTTGACAGAGCAGTGTTTAAATCATCCTACATTTCAGACTCAGAGACTTTTGGACCGGTCTCCTTCAAGATCAACAAAAAGGAAACCTTATCATGTGGAAAGCAGCACCCTGTCTAATAGAAACCAATCCACCAAGGGTGCTGCCTTACAGACTCACCACAGATCCAACAGCAAGGACATTCAGAACTTAAGTGTGGGTCTGCCCAGGGCTGAGGAAGGCCTGCCTGCAAACGAAAGCTTCCTCAATGGAAACCTTGCTGGAGCAACTCTCAGCCCAATGCACACCAAAACCTACCAAGCAAGCACCCAGCCTGGCTCTTCCAGCAAAGATCTCACAAACAACAACATACCACACCTTCTCAGTCCAAAAGAAGCCAAGTCCAAAACAGAGTTTGACTTCAATATTGACACAAAGCCTTCAGAAGGTCCAGGCACAAAGTACCTCAAGTCCAGCACCAGATCTCAGCAGAACAGGCACTCATTCATGGAAAGCTCCCAGAGCAAAGCTGGGACCCTGCAGCCCAGTGAGAAGCAGAGTCGGCACAGCTATATTGACACCATTCCCCAGTCCTCCCGGAGTCCATCCTACAGGACAAAGGCCAAAAGCCATGGGGCGTTGAGTGACTCCAAGTCTGTGAGCAACCTTTCCGAAGCCAGAGCCCAAATCACAGAGACTAATACCAGTAGATACTTCCCATCCAGTTGTTTGGACTTGAACTCTCCCACCAGCCCAACCCCCACCAGGCACACTGATACGAGAACTTTGCTCAGCCCTTCCGGTCGAAATAATAGAAATGAAGGCACTCTGGACTCACGGCGAACCACCACTAGACACTCAAAAACCATGGAGGAGTTGAAGCTGCCTGAACACATGGACAGCAGCCATTCGCATTCACTGTCTGCACCTCATGAATCATTTTCTTATGGGCTAGGCTACACCAGCCCCTTCTCCTCTCAGCAGCGTCCTCACAGGCATTCCATGTACGTGACCCGGGACAAAGTGAGAGCGAAAGGCCTTGATGGAAGCTTGAGCATAGGACAAGGGATGGCAGCCAGAGCCAACAGTTTGCAGCTCTTATCACCCCAGCCTGGAGAACAGCTCCCTCCAGAGATGACTGTGGCAAGACCTTCTGTTAAAGAGTCCTCCCGAGAAGGCGCCTCTTCATTCCACACCCGTCAGAAGTCTGAGGGTGGAGTATACCATGACCCACACTCTGACGACGGCACAGCTCCCAAAGAAAATCGGCATCTGTACAATGACCCTGTCCCAAGGAGAGTTGGTAGCTTTTATAGAGTGCCATCTCCACGACCAGACAATTCTTTCCATGAAAATAATGTGTCCACTCGAGTTTCTTCTCTGCCATCTGATAGCAGTTCTGGTACAAATCATTCAAAAAGACAACCAGGATTTGATCCATGGAAAAGTCCTGAAAACATTAGTCATGCCGATCAACTCAAAGAAAAGGAGAAGCAAGGTTTTTTCAGGTCAATGAAAAAGAAAAAGAAGAAAACTCAAACAGTGCCCAACACTGACGGTCCTGATCTATTGACCTTACAGAAAGCCATTCATTCTTCTAGCACTGCAAGCAGCAGACCAAAGGAGTGGCGACCTGAGAAGCTCTCAGATCTACAGACCCAGAGCCAACCACTAAAATCTCTTCGAAAGCTGTTGCATCTGTCTTCATCAACCAATCATCCAGCTTCTTCAGATCCTCGGTTCCAGCCCTTAACAGCTCAACAAGCCAAAAATTCCTTCTCAGAAATTCGGATTCACCCTCTGAGTCAGGCCACTGGTGGGAGCAGCAACATCCGGCAGGAGCCTACACCAAAAGGCAGACCAGCCCTTCAGTTGCCAGGATCTTCCCTCTTAAGGTACAACGGATGGAAACACTCAAGATCAAGATCCAGCCAGCCAGACGAAGTGATCTTCTTGGCATCCCATGAGAAATGGAAACAGccaccgaagaagaagcgcaaggtcTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDHDGDYKDHDIDYKDDDDKGS MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELL EEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEYVATRWYRSPELLLGAPYGKSVDMWSVGCI LGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQ RLLDRSPSRSTKRKPYHVESSTLSNRNQSTKGAALQTHHRSNSKDIQNLSVGLPRAEEGLPANESFLNGNLAGATLSPMHTKTYQASTQPGSSSKDLTNN NIPHLLSPKEAKSKTEFDFNIDTKPSEGPGTKYLKSSTRSQQNRHSFMESSQSKAGTLQPSEKQSRHSYIDTIPQSSRSPSYRTKAKSHGALSDSKSVSN LSEARAQITETNTSRYFPSSCLDLNSPTSPTPTRHTDTRTLLSPSGRNNRNEGTLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGYTS PFSSQQRPHRHSMYVTRDKVRAKGLDGSLSIGQGMAARANSLQLLSPQPGEQLPPEMTVARPSVKESSREGASSFHTRQKSEGGVYHDPHSDDGTAPKEN RHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSDSSSGTNHSKRQPGFDPWKSPENISHADQLKEKEKQGFFRSMKKKKKKTQTVPNTDGPD LLTLQKAIHSSSTASSRPKEWRPEKLSDLQTQSQPLKSLRKLLHLSSSTNHPASSDPRFQPLTAQQAKNSFSEIRIHPLSQATGGSSNIRQEPTPKGRPA LQLPGSSLLRYNGWKHSRSRSSQPDEVIFLASHEKWKQPPKKKRKV*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

CDKL5

cDNA Synonyms: 
EIEE2; ISSX; STK9
DU Number: 
DU67590
Cost of Production: 
200.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG CDKL5 R550*
Expressed: 
3Flag-CDKL5 R550*
Genbank: 
NM_003159.2 GI:83367066 with silent changes t996c and t2118c
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGAGTTGTACTTAAATGCAGACACAAGGAAACACATGAAATTGTGGCGATCAAGAAATTCAAGGACAGTGAAGAAAATGAAGAAGTCAAAGAAACGACTTTACGAGAGCTTAAAATGCTTCGGACTCTCAAGCAGGAAAACATTGTGGAGTTGAAGGAAGCATTTCGTCGGAGGGGAAAGTTGTACTTGGTGTTTGAGTATGTTGAAAAAAATATGCTCGAATTGCTGGAAGAAATGCCAAATGGAGTTCCACCTGAGAAAGTAAAAAGCTACATCTATCAGCTAATCAAGGCTATTCACTGGTGCCATAAGAATGATATTGTCCATCGAGATATAAAACCAGAAAATCTCTTAATCAGCCACAATGATGTCCTAAAACTGTGTGACTTTGGTTTTGCTCGTAATCTGTCAGAAGGCAATAATGCTAATTACACAGAGTACGTTGCCACCAGATGGTATCGGTCCCCAGAACTCTTACTTGGCGCTCCCTATGGAAAGTCCGTGGACATGTGGTCGGTGGGCTGTATTCTTGGGGAGCTTAGCGATGGACAGCCTTTATTTCCTGGAGAAAGTGAAATTGACCAACTTTTTACTATTCAGAAGGTGCTAGGACCACTTCCATCTGAGCAGATGAAGCTTTTCTACAGTAATCCTCGCTTCCATGGGCTCCGGTTTCCAGCTGTTAACCATCCTCAGTCCTTGGAAAGAAGATACCTTGGAATTTTGAATAGTGTTCTACTTGACCTAATGAAGAATTTACTGAAGTTGGACCCAGCTGACAGATACTTGACAGAACAGTGTTTGAATCACCCTACATTTCAAACCCAGAGACTTCTGGATCGTTCTCCTTCAAGGTCAGCAAAAAGAAAACCTTACCATGTGGAAAGCAGCACATTGTCTAATAGAAACCAAGCCGGCAAAAGCACTGCTTTGCAGTCTCACCACAGATCTAACAGCAAGGACATCCAGAACCTGAGTGTAGGCCTGCCCCGGGCTGACGAAGGTCTCCCTGCCAATGAAAGCTTCCTAAATGGAAACCTTGCTGGAGCTAGTCTTAGTCCACTGCACACCAAAACCTACCAAGCAAGCAGCCAGCCTGGGTCTACCAGCAAAGATCTCACCAACAACAACATACCACACCTTCTTAGCCCAAAAGAAGCCAAGTCAAAAACAGAGTTTGATTTTAATATTGACCCAAAGCCTTCAGAAGGCCCAGGGACAAAGTACCTCAAGTCAAACAGCAGATCTCAGCAGAACCGCCACTCATTCATGGAAAGCTCTCAAAGCAAAGCTGGGACACTGCAGCCCAATGAAAAGCAGAGTCGGCATAGCTATATTGACACAATTCCCCAGTCCTCTAGGAGTCCCTCCTACAGGACCAAGGCCAAAAGCCATGGGGCACTGAGTGACTCCAAGTCTGTGAGCAACCTTTCTGAAGCCAGGGCCCAAATTGCGGAGCCCAGTACCAGTAGGTACTTCCCATCTAGCTGCTTAGACTTGAATTCTCCCACCAGCCCAACCCCCACCAGACACAGTGACACGAGAACTTTGCTCAGCCCTTCTGGAAGAAATAACTGAAATGAGGGAACGCTGGACTCACGTCGAACCACAACCAGACATTCTAAGACGATGGAGGAATTGAAGCTGCCGGAGCACATGGACAGTAGCCATTCCCATTCACTGTCTGCACCTCACGAATCTTTTTCTTATGGACTGGGCTACACCAGCCCCTTTTCTTCCCAGCAACGTCCTCATAGGCATTCTATGTATGTGACCCGTGACAAAGTGAGAGCCAAGGGCTTGGATGGAAGCTTGAGCATAGGGCAAGGGATGGCAGCTAGAGCCAACAGCCTGCAACTCTTGTCACCCCAGCCTGGAGAACAGCTCCCTCCAGAGATGACTGTGGCAAGATCTTCGGTCAAAGAGACCTCCAGAGAAGGCACCTCTTCCTTCCATACACGCCAGAAGTCTGAGGGTGGAGTGTATCATGACCCACACTCTGATGATGGCACAGCCCCCAAAGAAAATAGACACCTATACAATGACCCTGTGCCAAGGAGAGTTGGTAGCTTTTACAGAGTGCCATCTCCACGTCCAGACAATTCTTTCCATGAAAATAATGTGTCAACTAGAGTTTCTTCTCTACCATCAGAGAGCAGTTCTGGAACCAACCACTCAAAAAGACAACCAGCATTCGATCCATGGAAAAGTCCTGAAAATATTAGTCATTCAGAGCAACTCAAGGAAAAAGAGAAGCAAGGATTTTTCAGGTCAATGAAAAAGAAAAAGAAGAAATCTCAAACAGTACCCAATTCCGACAGCCCTGATCTTCTGACGTTGCAGAAATCCATTCATTCTGCTAGCACTCCAAGCAGCAGACCAAAGGAGTGGCGCCCCGAGAAGATCTCAGATCTGCAGACCCAAAGCCAGCCATTAAAATCACTGCGCAAGTTGTTACATCTCTCTTCGGCCTCAAATCACCCGGCTTCCTCAGATCCCCGCTTCCAGCCCTTAACAGCTCAACAAACCAAAAATTCCTTCTCAGAAATTCGGATTCACCCCCTGAGCCAGGCCTCTGGCGGGAGCAGCAACATCCGGCAGGAACCCGCACCGAAGGGCAGGCCAGCCCTCCAGCTGCCAGACGGTGGATGTGATGGCAGAAGACAGAGACACCATTCTGGACCCCAAGATAGACGCTTCATGTTAAGGACGACAGAACAACAAGGAGAATACTTCTGCTGTGGTGACCCAAAGAAGCCTCACACTCCGTGCGTCCCAAACCGAGCCCTTCATCGTCCAATCTCCAGTCCTGCTCCCTATCCAGTACTCCAGGTCCGAGGCACTTCCATGTGCCCGACACTCCAGGTCCGAGGCACTGATGCTTTCAGCTGCCCAACCCAGCAATCCGGGTTCTCTTTCTTCGTGAGACACGTTATGAGGGAAGCCCTGATTCACAGGGCCCAGGTAAACCAAGCTGCGCTCCTGACATACCATGAGAATGCGGCACTGACGGGCAAGTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQEN IVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEY VATRWYRSPELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILNSVLL DLMKNLLKLDPADRYLTEQCLNHPTFQTQRLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHRSNSKDIQNLSVGLPRADEGLPANESFLNGNL AGASLSPLHTKTYQASSQPGSTSKDLTNNNIPHLLSPKEAKSKTEFDFNIDPKPSEGPGTKYLKSNSRSQQNRHSFMESSQSKAGTLQPNEKQSRHSYID TIPQSSRSPSYRTKAKSHGALSDSKSVSNLSEARAQIAEPSTSRYFPSSCLDLNSPTSPTPTRHSDTRTLLSPSGRNN*
Price: £125.00
Completion Time: 
7
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

CDKL5

cDNA Synonyms: 
EIEE2; ISSX; STK9
DU Number: 
DU67584
Cost of Production: 
200.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG CDKL5 M63Cfs13
Expressed: 
3Flag-CDKL5 M63Cfs13
Genbank: 
NM_003159.2 GI:83367066 with silent changes t996c and t2118c
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGAGTTGTACTTAAATGCAGACACAAGGAAACACATGAAATTGTGGCGATCAAGAAATTCAAGGACAGTGAAGAAAATGAAGAAGTCAAAGAAACGACTTTACGAGAGCTAAAATGCTTCGGACTCTCAAGCAGGAAAACATTGTGGAGTTGAAGGAAGCATTTCGTCGGAGGGGAAAGTTGTACTTGGTGTTTGAGTATGTTGAAAAAAATATGCTCGAATTGCTGGAAGAAATGCCAAATGGAGTTCCACCTGAGAAAGTAAAAAGCTACATCTATCAGCTAATCAAGGCTATTCACTGGTGCCATAAGAATGATATTGTCCATCGAGATATAAAACCAGAAAATCTCTTAATCAGCCACAATGATGTCCTAAAACTGTGTGACTTTGGTTTTGCTCGTAATCTGTCAGAAGGCAATAATGCTAATTACACAGAGTACGTTGCCACCAGATGGTATCGGTCCCCAGAACTCTTACTTGGCGCTCCCTATGGAAAGTCCGTGGACATGTGGTCGGTGGGCTGTATTCTTGGGGAGCTTAGCGATGGACAGCCTTTATTTCCTGGAGAAAGTGAAATTGACCAACTTTTTACTATTCAGAAGGTGCTAGGACCACTTCCATCTGAGCAGATGAAGCTTTTCTACAGTAATCCTCGCTTCCATGGGCTCCGGTTTCCAGCTGTTAACCATCCTCAGTCCTTGGAAAGAAGATACCTTGGAATTTTGAATAGTGTTCTACTTGACCTAATGAAGAATTTACTGAAGTTGGACCCAGCTGACAGATACTTGACAGAACAGTGTTTGAATCACCCTACATTTCAAACCCAGAGACTTCTGGATCGTTCTCCTTCAAGGTCAGCAAAAAGAAAACCTTACCATGTGGAAAGCAGCACATTGTCTAATAGAAACCAAGCCGGCAAAAGCACTGCTTTGCAGTCTCACCACAGATCTAACAGCAAGGACATCCAGAACCTGAGTGTAGGCCTGCCCCGGGCTGACGAAGGTCTCCCTGCCAATGAAAGCTTCCTAAATGGAAACCTTGCTGGAGCTAGTCTTAGTCCACTGCACACCAAAACCTACCAAGCAAGCAGCCAGCCTGGGTCTACCAGCAAAGATCTCACCAACAACAACATACCACACCTTCTTAGCCCAAAAGAAGCCAAGTCAAAAACAGAGTTTGATTTTAATATTGACCCAAAGCCTTCAGAAGGCCCAGGGACAAAGTACCTCAAGTCAAACAGCAGATCTCAGCAGAACCGCCACTCATTCATGGAAAGCTCTCAAAGCAAAGCTGGGACACTGCAGCCCAATGAAAAGCAGAGTCGGCATAGCTATATTGACACAATTCCCCAGTCCTCTAGGAGTCCCTCCTACAGGACCAAGGCCAAAAGCCATGGGGCACTGAGTGACTCCAAGTCTGTGAGCAACCTTTCTGAAGCCAGGGCCCAAATTGCGGAGCCCAGTACCAGTAGGTACTTCCCATCTAGCTGCTTAGACTTGAATTCTCCCACCAGCCCAACCCCCACCAGACACAGTGACACGAGAACTTTGCTCAGCCCTTCTGGAAGAAATAACCGAAATGAGGGAACGCTGGACTCACGTCGAACCACAACCAGACATTCTAAGACGATGGAGGAATTGAAGCTGCCGGAGCACATGGACAGTAGCCATTCCCATTCACTGTCTGCACCTCACGAATCTTTTTCTTATGGACTGGGCTACACCAGCCCCTTTTCTTCCCAGCAACGTCCTCATAGGCATTCTATGTATGTGACCCGTGACAAAGTGAGAGCCAAGGGCTTGGATGGAAGCTTGAGCATAGGGCAAGGGATGGCAGCTAGAGCCAACAGCCTGCAACTCTTGTCACCCCAGCCTGGAGAACAGCTCCCTCCAGAGATGACTGTGGCAAGATCTTCGGTCAAAGAGACCTCCAGAGAAGGCACCTCTTCCTTCCATACACGCCAGAAGTCTGAGGGTGGAGTGTATCATGACCCACACTCTGATGATGGCACAGCCCCCAAAGAAAATAGACACCTATACAATGACCCTGTGCCAAGGAGAGTTGGTAGCTTTTACAGAGTGCCATCTCCACGTCCAGACAATTCTTTCCATGAAAATAATGTGTCAACTAGAGTTTCTTCTCTACCATCAGAGAGCAGTTCTGGAACCAACCACTCAAAAAGACAACCAGCATTCGATCCATGGAAAAGTCCTGAAAATATTAGTCATTCAGAGCAACTCAAGGAAAAAGAGAAGCAAGGATTTTTCAGGTCAATGAAAAAGAAAAAGAAGAAATCTCAAACAGTACCCAATTCCGACAGCCCTGATCTTCTGACGTTGCAGAAATCCATTCATTCTGCTAGCACTCCAAGCAGCAGACCAAAGGAGTGGCGCCCCGAGAAGATCTCAGATCTGCAGACCCAAAGCCAGCCATTAAAATCACTGCGCAAGTTGTTACATCTCTCTTCGGCCTCAAATCACCCGGCTTCCTCAGATCCCCGCTTCCAGCCCTTAACAGCTCAACAAACCAAAAATTCCTTCTCAGAAATTCGGATTCACCCCCTGAGCCAGGCCTCTGGCGGGAGCAGCAACATCCGGCAGGAACCCGCACCGAAGGGCAGGCCAGCCCTCCAGCTGCCAGACGGTGGATGTGATGGCAGAAGACAGAGACACCATTCTGGACCCCAAGATAGACGCTTCATGTTAAGGACGACAGAACAACAAGGAGAATACTTCTGCTGTGGTGACCCAAAGAAGCCTCACACTCCGTGCGTCCCAAACCGAGCCCTTCATCGTCCAATCTCCAGTCCTGCTCCCTATCCAGTACTCCAGGTCCGAGGCACTTCCATGTGCCCGACACTCCAGGTCCGAGGCACTGATGCTTTCAGCTGCCCAACCCAGCAATCCGGGTTCTCTTTCTTCGTGAGACACGTTATGAGGGAAGCCCTGATTCACAGGGCCCAGGTAAACCAAGCTGCGCTCCTGACATACCATGAGAATGCGGCACTGACGGGCAAGTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKCFGLSSRKT LWS*
Price: £125.00
Completion Time: 
7
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

CDKL5

cDNA Synonyms: 
EIEE2; ISSX; STK9
DU Number: 
DU67582
Cost of Production: 
200.00
Plasmid: 
pcDNA5 FRT/TO 3FLAG CDKL5 E55Rfs20
Expressed: 
3Flag-CDKL5 E55Rfs20
Genbank: 
NM_003159.2 GI:83367066 with silent changes t996c and t2118c
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGAGTTGTACTTAAATGCAGACACAAGGAAACACATGAAATTGTGGCGATCAAGAAATTCAAGGACAGTGAAGAAAATGAAGAAGTCAAACGACTTTACGAGAGCTTAAAATGCTTCGGACTCTCAAGCAGGAAAACATTGTGGAGTTGAAGGAAGCATTTCGTCGGAGGGGAAAGTTGTACTTGGTGTTTGAGTATGTTGAAAAAAATATGCTCGAATTGCTGGAAGAAATGCCAAATGGAGTTCCACCTGAGAAAGTAAAAAGCTACATCTATCAGCTAATCAAGGCTATTCACTGGTGCCATAAGAATGATATTGTCCATCGAGATATAAAACCAGAAAATCTCTTAATCAGCCACAATGATGTCCTAAAACTGTGTGACTTTGGTTTTGCTCGTAATCTGTCAGAAGGCAATAATGCTAATTACACAGAGTACGTTGCCACCAGATGGTATCGGTCCCCAGAACTCTTACTTGGCGCTCCCTATGGAAAGTCCGTGGACATGTGGTCGGTGGGCTGTATTCTTGGGGAGCTTAGCGATGGACAGCCTTTATTTCCTGGAGAAAGTGAAATTGACCAACTTTTTACTATTCAGAAGGTGCTAGGACCACTTCCATCTGAGCAGATGAAGCTTTTCTACAGTAATCCTCGCTTCCATGGGCTCCGGTTTCCAGCTGTTAACCATCCTCAGTCCTTGGAAAGAAGATACCTTGGAATTTTGAATAGTGTTCTACTTGACCTAATGAAGAATTTACTGAAGTTGGACCCAGCTGACAGATACTTGACAGAACAGTGTTTGAATCACCCTACATTTCAAACCCAGAGACTTCTGGATCGTTCTCCTTCAAGGTCAGCAAAAAGAAAACCTTACCATGTGGAAAGCAGCACATTGTCTAATAGAAACCAAGCCGGCAAAAGCACTGCTTTGCAGTCTCACCACAGATCTAACAGCAAGGACATCCAGAACCTGAGTGTAGGCCTGCCCCGGGCTGACGAAGGTCTCCCTGCCAATGAAAGCTTCCTAAATGGAAACCTTGCTGGAGCTAGTCTTAGTCCACTGCACACCAAAACCTACCAAGCAAGCAGCCAGCCTGGGTCTACCAGCAAAGATCTCACCAACAACAACATACCACACCTTCTTAGCCCAAAAGAAGCCAAGTCAAAAACAGAGTTTGATTTTAATATTGACCCAAAGCCTTCAGAAGGCCCAGGGACAAAGTACCTCAAGTCAAACAGCAGATCTCAGCAGAACCGCCACTCATTCATGGAAAGCTCTCAAAGCAAAGCTGGGACACTGCAGCCCAATGAAAAGCAGAGTCGGCATAGCTATATTGACACAATTCCCCAGTCCTCTAGGAGTCCCTCCTACAGGACCAAGGCCAAAAGCCATGGGGCACTGAGTGACTCCAAGTCTGTGAGCAACCTTTCTGAAGCCAGGGCCCAAATTGCGGAGCCCAGTACCAGTAGGTACTTCCCATCTAGCTGCTTAGACTTGAATTCTCCCACCAGCCCAACCCCCACCAGACACAGTGACACGAGAACTTTGCTCAGCCCTTCTGGAAGAAATAACCGAAATGAGGGAACGCTGGACTCACGTCGAACCACAACCAGACATTCTAAGACGATGGAGGAATTGAAGCTGCCGGAGCACATGGACAGTAGCCATTCCCATTCACTGTCTGCACCTCACGAATCTTTTTCTTATGGACTGGGCTACACCAGCCCCTTTTCTTCCCAGCAACGTCCTCATAGGCATTCTATGTATGTGACCCGTGACAAAGTGAGAGCCAAGGGCTTGGATGGAAGCTTGAGCATAGGGCAAGGGATGGCAGCTAGAGCCAACAGCCTGCAACTCTTGTCACCCCAGCCTGGAGAACAGCTCCCTCCAGAGATGACTGTGGCAAGATCTTCGGTCAAAGAGACCTCCAGAGAAGGCACCTCTTCCTTCCATACACGCCAGAAGTCTGAGGGTGGAGTGTATCATGACCCACACTCTGATGATGGCACAGCCCCCAAAGAAAATAGACACCTATACAATGACCCTGTGCCAAGGAGAGTTGGTAGCTTTTACAGAGTGCCATCTCCACGTCCAGACAATTCTTTCCATGAAAATAATGTGTCAACTAGAGTTTCTTCTCTACCATCAGAGAGCAGTTCTGGAACCAACCACTCAAAAAGACAACCAGCATTCGATCCATGGAAAAGTCCTGAAAATATTAGTCATTCAGAGCAACTCAAGGAAAAAGAGAAGCAAGGATTTTTCAGGTCAATGAAAAAGAAAAAGAAGAAATCTCAAACAGTACCCAATTCCGACAGCCCTGATCTTCTGACGTTGCAGAAATCCATTCATTCTGCTAGCACTCCAAGCAGCAGACCAAAGGAGTGGCGCCCCGAGAAGATCTCAGATCTGCAGACCCAAAGCCAGCCATTAAAATCACTGCGCAAGTTGTTACATCTCTCTTCGGCCTCAAATCACCCGGCTTCCTCAGATCCCCGCTTCCAGCCCTTAACAGCTCAACAAACCAAAAATTCCTTCTCAGAAATTCGGATTCACCCCCTGAGCCAGGCCTCTGGCGGGAGCAGCAACATCCGGCAGGAACCCGCACCGAAGGGCAGGCCAGCCCTCCAGCTGCCAGACGGTGGATGTGATGGCAGAAGACAGAGACACCATTCTGGACCCCAAGATAGACGCTTCATGTTAAGGACGACAGAACAACAAGGAGAATACTTCTGCTGTGGTGACCCAAAGAAGCCTCACACTCCGTGCGTCCCAAACCGAGCCCTTCATCGTCCAATCTCCAGTCCTGCTCCCTATCCAGTACTCCAGGTCCGAGGCACTTCCATGTGCCCGACACTCCAGGTCCGAGGCACTGATGCTTTCAGCTGCCCAACCCAGCAATCCGGGTTCTCTTTCTTCGTGAGACACGTTATGAGGGAAGCCCTGATTCACAGGGCCCAGGTAAACCAAGCTGCGCTCCTGACATACCATGAGAATGCGGCACTGACGGGCAAGTGAGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKRLYESLKCFGLSSRKTL WS*
Price: £125.00
Completion Time: 
7
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.