StrepII

Sharpin

cDNA Synonyms: 
SHANK-associated RH domain interactor
DKFZp434N1923
SIPL1
hSIPL1
sharpin
shank-associated RH domain-interacting protein
shank-interacting protein-like 1
DU Number: 
DU71328
Cost of Production: 
150.00
Plasmid: 
pFBDMb-6His-3C-HOIL1, HOIP, StrepII-Sharpin
Expressed: 
StrepII-TEV-Sharpin
Genbank: 
NM_030974.4 → NP_112236.3
Species: 
Human
Vector Type: 
Baculovirus
Tag: 
Sequence of Insert: 
ggatccATGTGGTCCCACCCCCAGTTCGAGAAGGAAAACCTGTATTTTCAGGGCATGGCGCCGCCAGCGGGCGGGGCGGCGGCGGCGGCCTCGGACTTGGGCTCCGCCGCAGTGCTCTTGGCTGTGCACGCCGCGGTGAGGCCGCTGGGCGCCGGGCCAGACGCCGAGGCACAGCTGCGGAGGCTGCAGCTGAGCGCGGACCCTGAGAGGCCTGGGCGCTTCCGGCTGGAGCTGCTGGGCGCGGGACCTGGGGCGGTTAATTTGGAGTGGCCCCTGGAGTCAGTTTCCTACACCATCCGAGGCCCCACCCAGCACGAGCTACAGCCTCCACCAGGAGGGCCTGGAACCCTCAGCCTGCACTTCCTCAACCCTCAGGAAGCTCAGCGGTGGGCAGTCCTAGTCCGAGGTGCCACCGTGGAAGGACAGAATGGCAGCAAGAGCAACTCACCACCAGCCTTGGGCCCAGAAGCATGCCCTGTCTCCCTGCCCAGTCCCCCGGAAGCCTCCACACTCAAGGGCCCTCCACCTGAGGCAGATCTTCCTAGGAGCCCTGGAAACTTGACGGAGAGAGAAGAGCTGGCAGGGAGCCTGGCCCGGGCTATTGCAGGTGGAGACGAGAAGGGGGCAGCCCAAGTGGCAGCCGTCCTGGCCCAGCATCGTGTGGCCCTGAGTGTTCAGCTTCAGGAGGCCTGCTTCCCACCTGGCCCCATCAGGCTGCAGGTCACACTTGAAGACGCTGCCTCTGCCGCATCCGCCGCGTCCTCTGCACACGTTGCCCTGCAGGTCCACCCCCACTGCACTGTTGCAGCTCTCCAGGAGCAGGTGTTCTCAGAGCTCGGTTTCCCGCCAGCCGTGCAACGCTGGGTCATCGGACGGTGCCTGTGTGTGCCTGAGCGCAGCCTTGCCTCTTACGGGGTTCGGCAGGATGGGGACCCTGCTTTCCTCTACTTGCTGTCAGCTCCTCGAGAAGCCCCAGCCACAGGACCTAGCCCTCAGCACCCCCAGAAGATGGACGGGGAACTTGGACGCTTGTTTCCCCCATCATTGGGGCTACCCCCAGGCCCCCAGCCAGCTGCCTCCAGCCTGCCCAGTCCACTCCAGCCCAGCTGGTCCTGTCCTTCCTGCACCTTCATCAATGCCCCAGACCGCCCTGGCTGTGAGATGTGTAGCACCCAGAGGCCCTGCACTTGGGACCCCCTTGCTGCAGCTTCCACCTAGgcggccgc
Amino Acid Sequence: 
MWSHPQFEKENLYFQGMAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASAASSAHVALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLLSAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQPSWSCPSCTFINAPDRPGCEMCSTQRPCTWDPLAAAST*
Price: £125.00
Completion Time: 
108
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
TEV
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
Yes
Reagent Type: 

Sharpin

cDNA Synonyms: 
SHANK-associated RH domain interactor
DKFZp434N1923
SIPL1
hSIPL1
sharpin
shank-associated RH domain-interacting protein
shank-interacting protein-like 1
DU Number: 
DU71227
Cost of Production: 
120.00
Plasmid: 
pFBDMb-StrepII-TEV-Sharpin
Expressed: 
StrepII-TEV-Sharpin
Genbank: 
NM_030974.4 → NP_112236.3
Species: 
Human
Vector Type: 
Baculovirus
Tag: 
Sequence of Insert: 
ggatccATGTGGTCCCACCCCCAGTTCGAGAAGGAAAACCTGTATTTTCAGGGCATGGCGCCGCCAGCGGGCGGGGCGGCGGCGGCGGCCTCGGACTTGGGCTCCGCCGCAGTGCTCTTGGCTGTGCACGCCGCGGTGAGGCCGCTGGGCGCCGGGCCAGACGCCGAGGCACAGCTGCGGAGGCTGCAGCTGAGCGCGGACCCTGAGAGGCCTGGGCGCTTCCGGCTGGAGCTGCTGGGCGCGGGACCTGGGGCGGTTAATTTGGAGTGGCCCCTGGAGTCAGTTTCCTACACCATCCGAGGCCCCACCCAGCACGAGCTACAGCCTCCACCAGGAGGGCCTGGAACCCTCAGCCTGCACTTCCTCAACCCTCAGGAAGCTCAGCGGTGGGCAGTCCTAGTCCGAGGTGCCACCGTGGAAGGACAGAATGGCAGCAAGAGCAACTCACCACCAGCCTTGGGCCCAGAAGCATGCCCTGTCTCCCTGCCCAGTCCCCCGGAAGCCTCCACACTCAAGGGCCCTCCACCTGAGGCAGATCTTCCTAGGAGCCCTGGAAACTTGACGGAGAGAGAAGAGCTGGCAGGGAGCCTGGCCCGGGCTATTGCAGGTGGAGACGAGAAGGGGGCAGCCCAAGTGGCAGCCGTCCTGGCCCAGCATCGTGTGGCCCTGAGTGTTCAGCTTCAGGAGGCCTGCTTCCCACCTGGCCCCATCAGGCTGCAGGTCACACTTGAAGACGCTGCCTCTGCCGCATCCGCCGCGTCCTCTGCACACGTTGCCCTGCAGGTCCACCCCCACTGCACTGTTGCAGCTCTCCAGGAGCAGGTGTTCTCAGAGCTCGGTTTCCCGCCAGCCGTGCAACGCTGGGTCATCGGACGGTGCCTGTGTGTGCCTGAGCGCAGCCTTGCCTCTTACGGGGTTCGGCAGGATGGGGACCCTGCTTTCCTCTACTTGCTGTCAGCTCCTCGAGAAGCCCCAGCCACAGGACCTAGCCCTCAGCACCCCCAGAAGATGGACGGGGAACTTGGACGCTTGTTTCCCCCATCATTGGGGCTACCCCCAGGCCCCCAGCCAGCTGCCTCCAGCCTGCCCAGTCCACTCCAGCCCAGCTGGTCCTGTCCTTCCTGCACCTTCATCAATGCCCCAGACCGCCCTGGCTGTGAGATGTGTAGCACCCAGAGGCCCTGCACTTGGGACCCCCTTGCTGCAGCTTCCACCTAGgcggccgc
Amino Acid Sequence: 
MWSHPQFEKENLYFQGMAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASAASSAHVALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLLSAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQPSWSCPSCTFINAPDRPGCEMCSTQRPCTWDPLAAAST*
Price: £125.00
Completion Time: 
48
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
TEV
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
Yes
Reagent Type: 

Human TIMELESS

cDNA Synonyms: 
TIM
DU Number: 
DU70586
Plasmid: 
pLIB Strep-Tev-HsTIMELESS (pTL9)
Expressed: 
Strep-Tev-HsTIMELESS
Genbank: 
NM_003920.5
Species: 
Human
Vector Type: 
Baculovirus
Tag: 
Amino Acid Sequence: 
MGWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKGAGAGAGAGAGASENLYFQGGADLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHHQDKPLFDAVIRLMVNLTQPALLCFGNLPKEPSFRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEERQEEDNLLIERILLLVRNILHVPADLDQEKKIDDDASAHDQLLWAIHLSGLDDLLLFLASSSAEEQWSLHVLEIVSLMFRDQNPEQLAGVGQGRLAQERSADFAELEVLRQREMAEKKTRALQRGNRHSRFGGSYIVQGLKSIGERDLIFHKGLHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVRLFLRDFCSEFLENCYNRLMGSVKDHLLREKAQQHDETYYMWALAFFMAFNRAASFRPGLVSETLSVRTFHFIEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATVNEMDISPDEAVRESSRIIKNNIFYVMEYRELFLALFRKFDERCQPRSFLRDLVETTHLFLKMLERFCRSRGNLVVQNKQKKRRKKKKKVLDQAIVSGNVPSSPEEVEAVWPALAEQLQCCAQNSELSMDSVVPFDAASEVPVEEQRAEAMVRIQDCLLAGQAPQALTLLRSAREVWPEGDVFGSQDISPEEEIQLLKQILSAPLPRQQGPEERGAEEEEEEEEEEEEELQVVQVSEKEFNFLDYLKRFACSTVVRAYVLLLRSYQQNSAHTNHCIVKMLHRLAHDLKMEALLFQLSVFCLFNRLLSDPAAGAYKELVTFAKYILGKFFALAAVNQKAFVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLRELYLANKDVEGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQRKGTHIVLWTGDQELELQRLFEEFRDSDDVLGHIMKNITAKRSRARIVDKLLALGLVAERRELYKKRQKKLASSILPNGAESLKDFCQEDLEEEENLPEEDSEEEEEGGSEAEQVQGSLVLSNENLGQSLHQEGFSIPLLWLQNCLIRAADDREEDGCSQAVPLVPLTEENEEAMENEQFQQLLRKLGVRPPASGQETFWRIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQGSDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRYQIEDDEDD*
Price: £125.00
Completion Time: 
-18745
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Cost Centre: 
117609.D.C005.1673.1046
Extra Protein: 
No
Cleavage Site: 
TEV
Restricted Distribution: 
Not Restricted
COVID-19: 
No

CLASPIN

cDNA Synonyms: 
CLSPN
DU Number: 
DU70585
Plasmid: 
pLIB Strep-Tev-CLASPIN (pTL8)
Expressed: 
Strep-Tev-CLASPIN
Genbank: 
NM_022111.4
Species: 
Human
Vector Type: 
Baculovirus
Tag: 
Amino Acid Sequence: 
MGWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKGAGAGAGAGAGASENLYFQGGATGEVGSEVHLEINDPNVISQEEADSPSDSGQGSYETIGPLSEGDSDEEIFVSKKLKNRKVLQDSDSETEDTNASPEKTTYDSAEEENKENLYAGKNTKIKRIYKTVADSDESYMEKSLYQENLEAQVKPCLELSLQSGNSTDFTTDRKSSKKHIHDKEGTAGKAKVKSKRRLEKEERKMEKIRQLKKKETKNQEDDVEQPFNDSGCLLVDKDLFETGLEDENNSPLEDEESLESIRAAVKNKVKKHKKKEPSLESGVHSFEEGSELSKGTTRKERKAARLSKEALKQLHSETQRLIRESALNLPYHMPENKTIHDFFKRKPRPTCHGNAMALLKSSKYQSSHHKEIIDTANTTEMNSDHHSKGSEQTTGAENEVETNALPVVSKETQIITGSDESCRKDLVKNEELEIQEKQKQSDIRPSPGDSSVLQQESNFLGNNHSEECQVGGLVAFEPHALEGEGPQNPEETDEKVEEPEQQNKSSAVGPPEKVRRFTLDRLKQLGVDVSIKPRLGADEDSFVILEPETNRELEALKQRFWKHANPAAKPRAGQTVNVNVIVKDMGTDGKEELKADVVPVTLAPKKLDGASHTKPGEKLQVLKAKLQEAMKLRRFEERQKRQALFKLDNEDGFEEEEEEEEEMTDESEEDGEEKVEKEEKEEELEEEEEKEEEEEEEGNQETAEFLLSSEEIETKDEKEMDKENNDGSSEIGKAVGFLSVPKSLSSDSTLLLFKDSSSKMGYFPTEEKSETDENSGKQPSKLDEDDSCSLLTKESSHNSSFELIGSTIPSYQPCNRQTGRGTSFFPTAGGFRSPSPGLFRASLVSSASKSSGKLSEPSLPIEDSQDLYNASPEPKTLFLGAGDFQFCLEDDTQSQLLDADGFLNVRNHRNQYQALKPRLPLASMDENAMDANMDELLDLCTGKFTSQAEKHLPRKSDKKENMEELLNLCSGKFTSQDASTPASSELNKQEKESSMGDPMEEALALCSGSFPTDKEEEDEEEEFGDFRLVSNDNEFDSDEDEHSDSGNDLALEDHEDDDEEELLKRSEKLKRQMRLRKYLEDEAEVSGSDVGSEDEYDGEEIDEYEEDVIDEVLPSDEELQSQIKKIHMKTMLDDDKRQLRLYQERYLADGDLHSDGPGRMRKFRWKNIDDASQMDLFHRDSDDDQTEEQLDESEARWRKERIEREQWLRDMAQQGKITAEEEEEIGEDSQFMILAKKVTAKALQKNASRPMVIQESKSLLRNPFEAIRPGSAQQVKTGSLLNQPKAVLQKLAALSDHNPSAPRNSRNFVFHTLSPVKAEAAKESSKSQVKKRGPSFMTSPSPKHLKTDDSTSGLTRSIFKYLES*
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Cost Centre: 
117609.D.C005.1673.1046
Extra Protein: 
No
Cleavage Site: 
TEV
Restricted Distribution: 
Not Restricted
COVID-19: 
No

Human CTF4

cDNA Synonyms: 
WDHD1
DU Number: 
DU70584
Plasmid: 
pLIB Strep-Tev-HsCTF4 (pTL7)
Expressed: 
Strep-Tev-HsCTF4
Genbank: 
NM_007086.4
Species: 
Human
Vector Type: 
Baculovirus
Tag: 
Amino Acid Sequence: 
MGWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKGAGAGAGAGAGASENLYFQGGAPATRKPMRYGHTEGHTEVCFDDSGSFIVTCGSDGDVRIWEDLDDDDPKFINVGEKAYSCALKSGKLVTAVSNNTIQVHTFPEGVPDGILTRFTTNANHVVFNGDGTKIAAGSSDFLVKIVDVMDSSQQKTFRGHDAPVLSLSFDPKDIFLASASCDGSVRVWQISDQTCAISWPLLQKCNDVINAKSICRLAWQPKSGKLLAIPVEKSVKLYRRESWSHQFDLSDNFISQTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVEIPSFSKGIINDDEDDEDLMMASGRPRQRSHILEDDENSVDISMLKTGSSLLKEEEEDGQEGSIHNLPLVTSQRPFYDGPMPTPRQKPFQSGSTPLHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDTSIHHATHLSNTLNYTIADLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIIDLPQNEDIEAICLGQGWAAAATSALLLRLFTIGGVQKEVFSLAGPVVSMAGHGEQLFIVYHRGTGFDGDQCLGVQLLELGKKKKQILHGDPLPLTRKSYLAWIGFSAEGTPCYVDSEGIVRMLNRGLGNTWTPICNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAILSFKLPYCQIATEKGQMEEQFWRSVIFHNHLDYLAKNGYEYEESTKNQATKEQQELLMKMLALSCKLEREFRCVELADLMTQNAVNLAIKYASRSRKLILAQKLSELAVEKAAELTATQVEEEEEEEDFRKKLNAGYSNTATEWSQPRFRNQVEEDAEDSGEADDEEKPEIHKPGQNSFSKSTNSSDVSAKSGAVTFSSQGRVNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALSRTTNNEKSPIIKPLIPKPKPKQASAASYFQKRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQE*
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Cost Centre: 
117609.D.C005.1673.1046
Extra Protein: 
No
Cleavage Site: 
TEV
Restricted Distribution: 
Not Restricted
COVID-19: 
No

Human POLE2/POLE3/POLE4

cDNA Synonyms: 
DPB2, DPB3, DPB4
DU Number: 
DU70589
Plasmid: 
pBIG1b Human POLE2_Strep-Tev-POLE3_POLE4 (pTL12)
Expressed: 
Human POLE2_Strep-Tev-POLE3_POLE4
Genbank: 
NM_002692.4 for POLE2; ENST00000374169.7 for POLE3; NM_019896.4 for POLE4
Species: 
Human
Vector Type: 
Baculovirus
Tag: 
Sequence of Insert: 
see snapgene file
Amino Acid Sequence: 
see snapgene file
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Cost Centre: 
117609.D.C005.1673.1046
Extra Protein: 
No
Cleavage Site: 
TEV
Restricted Distribution: 
Not Restricted
COVID-19: 
No

Human ELOB/ELOC

cDNA Synonyms: 
Hippel-Lindau tumor suppressor, elongin B, elongin C
DU Number: 
DU70583
Plasmid: 
pBIG1b Human VHL_Strep-Tev-ELOB_ELOC (pTL6)
Expressed: 
Human VHL_Strep-Tev-ELOB_ELOC
Genbank: 
NM_000551.4 for VHL, NM_007108.4 for ELOB, ENST00000284811.12 for ELOC
Species: 
Human
Vector Type: 
Baculovirus
Tag: 
Sequence of Insert: 
see snapgene file
Amino Acid Sequence: 
see snapgene file
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Cost Centre: 
117609.D.C005.1673.1046
Extra Protein: 
No
Cleavage Site: 
TEV
Restricted Distribution: 
Not Restricted
COVID-19: 
No

Human LRR1_Strep-Tev-ELOB_ELOC

cDNA Synonyms: 
LRR1, Elongin B, Elongin C
DU Number: 
DU70582
Plasmid: 
pBIG1b Human LRR1_Strep-Tev-ELOB_ELOC (pTL5)
Expressed: 
Human LRR1_Strep-Tev-ELOB_ELOC
Genbank: 
NM_152329.4 for LRR1, NM_007108.4 for ELOB, ENST00000284811.12 for ELOC
Species: 
Human
Vector Type: 
Baculovirus
Tag: 
Sequence of Insert: 
see snapgene file
Amino Acid Sequence: 
see snapgene file
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Cost Centre: 
117609.D.C005.1673.1046
Extra Protein: 
No
Cleavage Site: 
TEV
Restricted Distribution: 
Not Restricted
COVID-19: 
No

(Rat)Fbx45

cDNA Synonyms: 
SPRY domain-containing protein 1
DU Number: 
DU65636
Plasmid: 
pFBDM-SKP1 isoform 1, StrepII-3C-(Rat)Fbxo45
Expressed: 
StrepII-3C-(Rat)Fbxo45
Genbank: 
XM_017598223.1 Uniprot: A0A0G2JWY6
Species: 
Rat
Vector Type: 
Baculovirus
Tag: 
Sequence of Insert: 
ccATGGGTTGGTCTCATCCTCAATTCGAGAAGCTGGAGGTGCTGTTCCAG GGTCCTGGTCCTGGTGCTGGTGCTCCTGCTGGTAGCGGTGCTGCTGGTGG TCCTGCTTCAGCTAGAGGCGCTTCTGCTGGTGCTGGTTCTGCTTCATCTG GTATCGGTGGTAGACTCGATCAAGCTGGTGCTTGGATGGTTTTCTCTTCA TGGTCTTGCCCAGCTTGCGGTTCTTGTGCTCTGGTATGCAGGCAGGGTAC CGCTGCTCTGCACGGAGATGAAACTTCCGAGGTGTGGCGCTCCCTGTGCG CTCGCTCCCTGGCTGAGGAGGCTCTGCGTACAGACATCCTGTGCAACCTG CCCAGCTACAAGGCAAAGGTTCGCGCCTTCCAACACGCCTTTTCTACTAA CGATTGCTCTCGCAATGTGTACATCAAAAAGAACGGGTTTACTCTGCACA GGAACCCTATCGCTCAATCCACCGACGGTGCTCGTACCAAGATCGGTTTC TCCGAGGGTCGCCACGCGTGGGAAGTGTGGTGGGAGGGCCCACTGGGTAC AGTGGCTGTGATCGGTATCGCTACCAAGCGCGCTCCCATGCAGTGCCAGG GCTACGTGGCTCTGCTGGGCTCCGACGACCAGTCCTGGGGTTGGAACTTG GTGGACAACAACCTGCTGCACAACGGAGAGGTGAACGGTTCCTTCCCCCA GTGCAACAACGCTCCTAAGTATCAGATCGGCGAGCGTATCCGCGTGATCC TGGACATGGAGGACAAGACCCTGGCTTTCGAGCGCGGCTACGAGTTCCTG GGTGTGGCTTTCCGCGGTCTGCCTAAGGCTTGCCTTTACCCCGCCGTTTC TGCCGTTTATGGCAACACCGAGGTCACTCTTGTATACCTGGGAAAGCCTC TGGACGGTTAAGCATGC
Amino Acid Sequence: 
MGWSHPQFEKLEVLFQGPGPGAGAPAGSGAAGGPASARGASAGAGSASSG IGGRLDQAGAWMVFSSWSCPACGSCALVCRQGTAALHGDETSEVWRSLCA RSLAEEALRTDILCNLPSYKAKVRAFQHAFSTNDCSRNVYIKKNGFTLHR NPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQG YVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVIL DMEDKTLAFERGYEFLGVAFRGLPKACLYPAVSAVYGNTEVTLVYLGKPL DG*
Price: £125.00
Completion Time: 
145
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No

SARS-Cov2 Nsp3

DU Number: 
DU67898
Cost of Production: 
200.00
Plasmid: 
pET15D Twinstrep 3C SARS CoV-2 Nsp3 N179-N1329 C856A 6His
Expressed: 
Twinstrep 3C Nsp3 N179-N1329 C856A 6His
Genbank: 
MN908947.3
Species: 
SARS-CoV-2
Vector Type: 
Bacterial
Tag: 
Sequence of Insert: 
See snapgene file
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
25
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
PreScission
Restricted Distribution: 
Not Restricted
COVID-19: 
Yes

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.