6His

NPL4 (Human)

cDNA Synonyms: 
NPLOC4, KIAA1499
DU Number: 
DU73316
Plasmid: 
pET28c
Expressed: 
NPL4 (Human)
Genbank: 
NP_060391.2
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASS NKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAPNVVEDEIDQYLSKQDGK IYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKF VALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDF WRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIA AKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNMCRLSPD GHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQY VPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLG ETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELA QTWKRSEQWATIEQLCSTVGGQLPGLHEYGAVGGSTHTATAAMWACQHCTFMNQPGTGHC EMCSLPRT
Price: £110.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
117127.D.C001.2287.1046
Extra Protein: 
No
Cleavage Site: 
Thrombin
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

UBCH5c

cDNA Synonyms: 
UBE2D3
DU Number: 
DU71209
Plasmid: 
pSc-B- 6His-UbcH5C [C21S C107S C111S]
Genbank: 
NM_003340
Species: 
Human
Vector Type: 
Other
Tag: 
Sequence of Insert: 
CATATGCATCACCATCACCATCACATGGCGCTGAAACGGATTAATAAGGAACTTAGTGATTTGGCCCGTGACCCTCCAGCACAATCTTCTGCAGGTCCAGTTGGGGATGATATGTTTCATTGGCAAGCCACAATTATGGGACCTAATGACAGCCCATATCAAGGCGGTGTATTCTTTTTGACAATTCATTTTCCTACAGACTACCCCTTCAAACCACCTAAGGTTGCATTTACAACAAGAATTTATCATCCAAATATTAACAGTAATGGCAGCATTTGTCTCGATATTCTAAGATCACAGTGGTCGCCTGCTTTAACAATTTCTAAAGTTCTTTTATCCATTTCTTCACTGCTATCTGATCCAAACCCAGATGACCCCCTAGTGCCAGAGATTGCACGGATCTATAAAACAGACAGAGATAAGTACAACAGAATATCTCGGGAATGGACTCAGAAGTATGCCATGGCGGCCGC
Amino Acid Sequence: 
MHHHHHHMALKRINKELSDLARDPPAQSSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSISSLLSDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Price: £110.00
Completion Time: 
53
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
PreScission
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

TYRO3 (468 - 890)

Long Name: 
TYRO3 protein tyrosine kinase
Accession: 
NM_006293.4
Catalog Number (DU Number): 
DU61217
Protein Activity: 
Expression: 
Purification Method: 
GSH Sepharose
Mono-Isotopic Mass: 
73, 802.14 daltons
Average Mass: 
73, 850.01 daltons
Theoretical PI: 
5.40
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM sucrose, 150 mM NaCl, 0.1 mM EGTA, 10 mM DTT, 0.02 % Brij-35, 0.2 mM PMSF, 1 mM Benzamidine.
Storage Temperature: 
-70 °C
Assay Buffer: 
50 mM Tris-HCl pH 7.5, 0.1mM EGTA, 10 mM DTT, 10 mM MgAc
Assay Substrate: 
Poly Glu Tyr (4:1) Final concentration: 0.1 mg/ml
Native Sequence: 
Amino acids M468 – C890 (end) of human TYRO3. Residue M232 of the fusion protein is equivalent to M468 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission site (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 and Not1 sites of pFastBac GST 6P1
Target Family: 
Price: £110.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Friday, 24 September, 2021 - 09
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

MET (1051 - 1349)

Long Name: 
MET proto-oncogene, receptor tyrosine kinase
Accession: 
NM_000245.4
Catalog Number (DU Number): 
DU61348
Protein Activity: 
Expression: 
Purification Method: 
GSH Sepharose
Mono-Isotopic Mass: 
60, 683.10 daltons
Average Mass: 
60, 722.54 daltons
Theoretical PI: 
6.68
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM sucrose, 150 mM NaCl, 0.1 mM EGTA, 10 mM DTT, 0.02 % Brij-35, 0.2 mM PMSF, 1 mM Benzamidine.
Storage Temperature: 
-70 °C
Assay Buffer: 
50 mM Tris-HCl pH 7.5, 0.1mM EGTA, 10 mM DTT, 10 mM MgAc
Assay Substrate: 
GGMEDIYFEFMGGKKK Final concentration: 300 uM
Native Sequence: 
Amino acids V1051– Y1390 (end) of human MET. Residue V232 of the fusion protein is equivalent to V1051 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission site (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 and Not1 sites of pFastBac GST 6P1
Target Family: 
Price: £110.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Thursday, 23 September, 2021 - 14
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

UBC13

cDNA Synonyms: 
ube2N
MGC131857
MGC8489
UBC13
UbcH-ben
bendless-like ubiquitin conjugating enzyme
bendless-like ubiquitin-conjugating enzyme
ubiquitin carrier protein N
ubiquitin-conjugating enzyme E2 N
ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13)
ubiquitin-protein ligase N
yeast UBC13 homolog
DU Number: 
DU65894
Cost of Production: 
80.00
Plasmid: 
pETduet 6His UBC13 C88K K93A L107A
Expressed: 
6His UBC13 C88K K93A L107A
Genbank: 
NP_003339.1
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MGSSHHHHHHSQDPMAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRIKLDILADKWSPALQIRTVLASIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI*
Price: £110.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
114396.D.C001.1115.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
Yes

UBC13

cDNA Synonyms: 
ube2N
MGC131857
MGC8489
UBC13
UbcH-ben
bendless-like ubiquitin conjugating enzyme
bendless-like ubiquitin-conjugating enzyme
ubiquitin carrier protein N
ubiquitin-conjugating enzyme E2 N
ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13)
ubiquitin-protein ligase N
yeast UBC13 homolog
DU Number: 
DU65893
Cost of Production: 
80.00
Plasmid: 
pETduet 6His UBC13 M65K C88K K93A
Expressed: 
6His UBC13 M65K C88K K93A
Genbank: 
NP_003339.1
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MGSSHHHHHHSQDPMAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPKAAPKVRFMTKIYHPNVDKLGRIKLDILADKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI*
Price: £110.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
114396.D.C001.1115.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
Yes
Reagent Type: 

UBC13

cDNA Synonyms: 
ube2N
MGC131857
MGC8489
UBC13
UbcH-ben
bendless-like ubiquitin conjugating enzyme
bendless-like ubiquitin-conjugating enzyme
ubiquitin carrier protein N
ubiquitin-conjugating enzyme E2 N
ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13)
ubiquitin-protein ligase N
yeast UBC13 homolog
DU Number: 
DU65886
Plasmid: 
pETduet 6His UBC13 L107A
Expressed: 
6His UBC13 L107A
Genbank: 
NP_003339.1
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Sequence of Insert: 
GGATCCAATGGCCGGGCTGCCCCGCAGGATCATCAAGGAAACCCAGCGTTTGCTGGCAGAACCAGTTCCTGGCATCAAAGCCGAACCAGATGAGAGCAACGCCCGTTATTTTCATGTGGTCATTGCTGGCCCTCAGGATTCCCCCTTTGAGGGAGGGACTTTTAAACTTGAACTATTCCTTCCAGAAGAATACCCAATGGCAGCCCCTAAAGTACGTTTCATGACCAAAATTTATCATCCTAATGTAGACAAGTTGGGAAGAATATGTTTAGATATTTTGAAAGATAAGTGGTCCCCAGCACTGCAGATCCGCACAGTTCTGgcATCGATCCAGGCCTTGTTAAGTGCTCCCAATCCAGATGATCCATTAGCAAATGATGTAGCGGAGCAGTGGAAGACCAACGAAGCCCAAGCCATAGAAACAGCTAGAGCATGGACTAGGCTATATGCCATGAATAATATTTAAGCGGCCGC
Amino Acid Sequence: 
MGSSHHHHHHSQDPMAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFH VVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRI CLDILKDKWSPALQIRTVLASIQALLSAPNPDDPLANDVAEQWKTNEAQA IETARAWTRLYAMNNI*
Price: £110.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
114396.D.C001.1115.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
Yes
Reagent Type: 

UBC13

cDNA Synonyms: 
ube2N
MGC131857
MGC8489
UBC13
UbcH-ben
bendless-like ubiquitin conjugating enzyme
bendless-like ubiquitin-conjugating enzyme
ubiquitin carrier protein N
ubiquitin-conjugating enzyme E2 N
ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13)
ubiquitin-protein ligase N
yeast UBC13 homolog
DU Number: 
DU65885
Cost of Production: 
80.00
Plasmid: 
pETduet 6His UBC13 M65K
Expressed: 
6His UBC13 M65K
Genbank: 
NP_003339.1
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Sequence of Insert: 
GGATCCAATGGCCGGGCTGCCCCGCAGGATCATCAAGGAAACCCAGCGTTTGCTGGCAGAACCAGTTCCTGGCATCAAAGCCGAACCAGATGAGAGCAACGCCCGTTATTTTCATGTGGTCATTGCTGGCCCTCAGGATTCCCCCTTTGAGGGAGGGACTTTTAAACTTGAACTATTCCTTCCAGAAGAATACCCAAaGGCAGCCCCTAAAGTACGTTTCATGACCAAAATTTATCATCCTAATGTAGACAAGTTGGGAAGAATATGTTTAGATATTTTGAAAGATAAGTGGTCCCCAGCACTGCAGATCCGCACAGTTCTGCTATCGATCCAGGCCTTGTTAAGTGCTCCCAATCCAGATGATCCATTAGCAAATGATGTAGCGGAGCAGTGGAAGACCAACGAAGCCCAAGCCATAGAAACAGCTAGAGCATGGACTAGGCTATATGCCATGAATAATATTTAAGCGGCCGC
Amino Acid Sequence: 
MGSSHHHHHHSQDPMAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFH VVIAGPQDSPFEGGTFKLELFLPEEYPKAAPKVRFMTKIYHPNVDKLGRI CLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQA IETARAWTRLYAMNNI*
Price: £110.00
Completion Time: 
23
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
114396.D.C001.1115.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
Yes
Reagent Type: 

HOIP

cDNA Synonyms: 
ring finger protein 31 (RNF31) (HOIP)
DU Number: 
DU65848
Cost of Production: 
150.00
Plasmid: 
pET156His SUMO-HOIP
Expressed: 
6His SUMO-HOIP
Genbank: 
NM_017999.4 Q96EP0
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGMPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLEDKVEDDMLQLSEFDPLLREIAPGPLTTPSVPGSTPGPCFLCGSAPGTLHCPSCKQALCPACDHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQSTSLLALGDSSLSSPNPASAHLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGPQGTGGLEPDLARGRWACQSCTFENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTFCNSSPGWVCVMCNRTSSPIPAQHAPRPYASSLEKGPPKPGPPRRLSAPLPSSCGDPEKQRQDKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK*
Price: £110.00
Completion Time: 
89
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
Yes
Reagent Type: 

Rnf12 (mouse)

Catalog Number (DU Number): 
DU61391
Native Sequence: 
GGATCCATGCACCATCACCATCACCATATGGAGAACTCAGATTCTAACGATAAAGGAAGTGACCAGTCTGCAGCTCAGCGCAGAAGTCAAATGGATCGCTTGGATCGGGAAGAGGCTTTCTATCAATTTGTGAATAATCTCAGTGAAGAAGATTATAGACTTATGAGAGACAACAATTTGCTGGGCACCCCAGGTGAAAGTACTGAGGAAGAGTTGCTCAGAAGACTACAACAAATTAAAGAGGGTCCACCACCACAGAGCCCCGATGAAAATAGAGCTGGAGAGTCTTCAGATGATGTGACCAACAGTGATTCTATAATAGATTGGCTTAACTCAGTCAGACAGACTGGAAATACAACAAGAAGTGGTCAGAGAGGAAACCAGTCCTGGAGAGCAGTGAGCCGGACTAATCCAAACAGCGGTGATTTCAGATTCAGTTTAGAGATAAATGTTAACCGTAACAATGGAAGCCAAACTTCCGAGAATGAAAGTGAACCATCCACTAGGCGTCTTAGTGTAGAAAACATGGAGAGCAGCAGCCAAAGGCAAATGGAAAATTCTGCATCTGAATCAGCATCGGCCAGACCTTCTCGAGCGGAGCGCAATTCAGCTGAAGCAGTAACAGAAGTGCCGACCACCAGAGCTCAGAGGAGGGCAAGAAGCCGGAGCCCAGAGCATCGGAGAACCAGAGCAAGAGCTGAAAGAAGCAGGTCCCCTCTGCAGCCAACAAGTGAAATTCCACGAAGAGCTCCGACCTTGGAGCAGTCTTCGGAAAACGAGCCTGAAGGAAGTTCTAGAACCCGGCACCATGTGACCCTGAGACAGCAGATATCTGGACCGGAGTTGTTAGGTAGAGGTCTTTTTGCAGCTTCTGGATCAAGAAACCCCTCTCAGGGGACAAGCTCTTCAGACACAGGTAGCAATAGTGAATCCTCAGGATCTGGCCAAAGACCTCCAACCATAGTTCTTGATCTTCAAGTAAGAAGAGTTCGTCCTGGAGAATACCGGCAGAGAGATAGTATAGCTAGCAGAACTCGATCAAGATCTCAGGCTCCGAACAACACAGTTACTTATGAAAGTGAACGTGGAGGTTTTAGGCGTACCTTTTCCCGTTCTGAACGTGCAGGTGTGAGAACCTATGTGAGTACTATCAGGATTCCTATTCGCAGAATCTTAAATACTGGATTAAGTGAAACTACATCTGTTGCAATTCAAACCATGTTAAGGCAGATAATGACAGGCTTTGGTGAGCTAAGCTACTTTATGTACAGTGACAGTGATTCAGAGCCTAGTGCCTCAGTCTCCAGCCGAAATGTGGAGAGAGTAGAGTCACGGAATGGAAGAGGGAGCTCTGGTGGCGGTAACAGCTCTGGTTCCAGTTCCAGCTCAAGTCCTAGCCCCAGTTCAAGTGGTGAAAGTTCCGAGAGTAGCTCAGAGATGTTCGAAGGCAGTAGTGAAGGAGGCTCGTCTGGCCCATCCAGAAGAGATGGTCGACATAGGGCCCCAGTCACATTTGATGAAAGTGGCTCTCTGCCATTCCTTAGTCTGGCTCAGTTTTTTCTTTTAAATGAAGATGATGAAGACCAACCTAGAGGACTCACTAAAGAACAGATCGATAACTTGGCAATGAGAAGCTTTGGTGAAAATGATGCATTGAAAACGTGTAGTGTTTGCATTACAGAATACACAGAAGGCAACAAACTTCGTAAACTACCTTGCTCCCATGAGTACCACGTCCACTGCATCGACCGCTGGTTGTCTGAGAATTCCACCTGTCCCATTTGTCGCAGGGCAGTCTTATCTTCTGGGAACAGAGAAAGTGTTGTGTGAGCGGCCGC
Price: £110.00
Species: 
Tag: 
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Auto Generated: 
Yes
Final Product: 
COVID-19: 
No
Ubiquitylation Site: 
Yes

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.