mCherry

SNX9

cDNA Synonyms: 
SDP1; SH3PX1; SH3PXD3A; WISP
DU Number: 
DU61257
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO mCherry SNX9
Expressed: 
mCherry SNX9
Genbank: 
NM_016224.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCCACCAAGGCTCGGGTTATGTATGATTTTGCTGCTGAACCTGGAAATAATGAACTGACGGTTAATGAAGGAGAAATCATCACAATCACAAATCCGGATGTAGGTGGAGGATGGCTGGAAGGAAGAAACATCAAAGGAGAACGAGGGCTGGTTCCCACAGACTACGTTGAAATTTTACCCAGTGATGGAAAAGATCAATTTTCTTGTGGAAATTCAGTGGCTGACCAAGCCTTCCTTGATTCTCTCTCAGCCAGCACAGCTCAGGCCAGTTCGTCGGCTGCCAGCAACAATCACCAGGTTGGCAGTGGCAATGACCCCTGGTCAGCCTGGAGTGCCTCCAAATCTGGGAACTGGGAAAGCTCAGAAGGCTGGGGGGCCCAGCCAGAGGGGGCTGGAGCCCAAAGAAACACAAACACTCCCAACAACTGGGACACTGCCTTCGGCCACCCCCAGGCCTACCAAGGACCAGCAACTGGTGATGATGATGACTGGGATGAAGACTGGGATGGGCCCAAATCCTCTTCCTACTTTAAGGATTCAGAGTCAGCTGATGCAGGCGGCGCTCAGCGAGGAAACAGTCGTGCTAGTTCCTCATCCATGAAAATTCCCCTTAACAAATTTCCTGGATTTGCGAAACCTGGCACGGAACAGTATTTGTTGGCCAAACAACTAGCAAAACCCAAAGAGAAAATTCCCATCATTGTTGGAGATTATGGCCCAATGTGGGTTTATCCTACCTCTACTTTTGACTGTGTGGTAGCAGATCCCAGGAAAGGCTCCAAAATGTATGGTCTAAAGAGCTACATCGAATATCAGCTAACACCTACTAACACTAATCGATCTGTAAACCACAGGTATAAGCACTTTGACTGGTTATATGAGCGTCTCCTGGTTAAGTTTGGGTCAGCCATTCCAATCCCTTCTCTTCCAGACAAACAAGTCACAGGCCGCTTTGAAGAGGAATTTATCAAAATGCGCATGGAGAGACTTCAGGCCTGGATGACCAGGATGTGTCGCCATCCAGTAATCTCAGAAAGTGAAGTTTTCCAGCAGTTCCTAAATTTCCGAGATGAGAAGGAATGGAAAACTGGAAAGAGGAAGGCCGAGAGAGATGAGCTGGCGGGAGTCATGATATTTTCCACCATGGAACCAGAGGCACCTGACTTGGACTTAGTAGAAATAGAGCAGAAGTGCGAGGCTGTGGGGAAGTTCACCAAGGCCATGGATGACGGCGTGAAGGAGCTGCTGACGGTGGGGCAGGAGCACTGGAAGCGCTGCACGGGCCCATTACCCAAGGAATATCAGAAGATAGGAAAGGCCTTGCAGAGTTTGGCCACAGTGTTCAGTTCCAGTGGCTATCAAGGTGAAACAGATCTCAATGATGCAATAACAGAAGCAGGAAAGACTTATGAAGAAATTGCCAGTCTCGTGGCAGAACAGCCAAAGAAAGATCTCCATTTCCTGATGGAATGTAATCACGAGTATAAAGGTTTTCTTGGCTGCTTCCCTGACATCATTGGCACTCACAAGGGAGCAATAGAAAAAGTGAAAGAAAGTGACAAACTAGTTGCAACAAGTAAAATCACCCTACAAGACAAACAGAACATGGTGAAGAGAGTCAGCATCATGTCTTACGCGTTGCAAGCTGAGATGAATCACTTTCACAGTAACCGGATCTATGATTACAACAGTGTCATCCGCCTGTACCTGGAGCAGCAAGTGCAATTTTACGAAACGATTGCAGAAAAGCTGAGGCAGGCCCTCAGCCGCTTTCCAGTGATGTAGCGGCCGC
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKSGLGSMATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEI LPSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPAT GDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRK GSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDE KEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETD LNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNR IYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM*
Price: £110.00
Completion Time: 
11
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811497.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No

mCherry/GFP

DU Number: 
DU67583
Plasmid: 
pBabe hygro mCherry GFP SKL (Deposited by Lea Wilhelm)
Expressed: 
mCherry GFP SKL
Genbank: 
-
Vector Type: 
Mammalian
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKGGGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPT LVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKN GIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSKL*
Price: £110.00
Completion Time: 
0
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

FIS1

cDNA Synonyms: 
mitochondrial fission protein 1
DU Number: 
DU65472
Cost of Production: 
80.00
Plasmid: 
pBabe puro mCherry-Fis aa101-152 (end)
Expressed: 
mCherry Fis1 101-152
Genbank: 
NP_057152.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCGAGCCCCAGAACAACCAGGCCAAGGAACTGGAGCGGCTCATTGACAAGGCCATGAAGAAAGATGGACTCGTGGGCATGGCCATCGTGGGAGGCATGGCCCTGGGTGTGGCGGGACTGGCCGGACTCATCGGACTTGCTGTGTCCAAGTCCAAATCCTGAGCGGCCGC
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA SSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKGGGSEPQNNQAKEL ERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS*
Price: £110.00
Completion Time: 
15
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

POLA1

cDNA Synonyms: 
NSX, POLA, p180
DU Number: 
DU64729
Plasmid: 
pcDNA5 frtTO mCherry POLA1 (missing 1086-2309 bp)
Expressed: 
mCherry-POLA1 (delta 1086-2309 bp)
Genbank: 
NM_016937.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
agatctATGGCACCTGTGCACGGCGACGACTGTGAGATAGGGGCGAGTGCTCTGTCAGATTCAGGGAGTTTTGTATCTTCTCGAGCCCGGCGAGAAAAAAAATCAAAGAAGGGGCGCCAAGAAGCCCTAGAAAGACTGAAAAAGGCTAAAGCTGGTGAGAAGTATAAATATGAAGTCGAGGACTTCACAGGTGTTTATGAAGAAGTTGATGAAGAACAGTATTCGAAGCTGGTTCAGGCACGCCAGGATGATGACTGGATTGTGGATGATGATGGTATTGGCTATGTGGAAGATGGCCGAGAGATTTTTGATGATGACCTTGAAGATGATGCCCTTGATGCTGATGAGAAAGGAAAAGATGGTAAAGCACGCAATAAAGACAAGAGGAATGTAAAGAAGCTCGCAGTGACAAAACCGAACAACATTAAGTCAATGTTCATTGCTTGTGCTGGAAAGAAAACTGCAGATAAAGCTGTAGACTTGTCCAAGGATGGTCTGCTAGGTGACATTCTACAGGATCTTAACACTGAGACACCTCAAATAACTCCACCACCTGTAATGATACTGAAGAAGAAAAGATCCATTGGAGCTTCACCGAATCCTTTCTCTGTGCACACCGCCACGGCAGTTCCTTCAGGAAAAATTGCTTCCCCTGTCTCCAGAAAGGAGCCTCCATTAACTCCTGTTCCTCTTAAACGTGCTGAATTTGCTGGCGATGATGTACAGGTCGAGAGTACAGAAGAAGAGCAGGAGTCAGGGGCAATGGAGTTTGAAGATGGTGACTTTGATGAGCCCATGGAAGTTGAAGAGGTGGACCTGGAGCCTATGGCTGCCAAGGCTTGGGACAAAGAGAGTGAGCCAGCAGAGGAAGTGAAACAAGAGGCGGATTCTGGGAAAGGGACCGTGTCCTACTTAGGAAGTTTTCTCCCGGATGTCTCTTGTTGGGACATTGATCAAGAAGGTGATAGCAGTTTCTCAGTGCAAGAAGTTCAAGTGGATTCCAGTCACCTCCCATTGGTAAAAGGGGCAGATGAGGAACAAGTATTCCACTTTTATTGGTTGGATGCTTATGAGGATCAGTACAACCAACCAGCATTGCAGATCACTAACATCGCTGGGAACATTATGTCCAGGACGCTGATGGGTGGACGATCCGAGCGTAACGAGTTCTTGTTGCTTCATGCATTTTACGAAAACAACTATATTGTGCCTGACAAGCAGATTTTCAGAAAGCCTCAGCAAAAACTGGGAGATGAAGATGAAGAAATTGATGGAGATACCAATAAATACAAGAAAGGACGTAAGAAAGCAGCTTATGCTGGAGGCTTGGTTTTGGACCCCAAAGTTGGTTTTTATGATAAGTTCATTTTGCTTCTGGACTTCAACAGTCTATATCCTTCCATCATTCAGGAATTTAACATTTGTTTTACAACAGTACAAAGAGTTGCTTCAGAGGCACAGAAAGTTACAGAGGATGGAGAACAAGAACAGATCCCTGAGTTGCCAGATCCAAGCTTAGAAATGGGCATTTTGCCCAGAGAGATCCGGAAACTGGTAGAACGGAGAAAACAAGTCAAACAGCTAATGAAACAGCAAGACTTAAATCCAGACCTTATTCTTCAGTATGACATTCGACAGAAGGCTTTGAAGCTCACAGCGAACAGTATGTATGGTTGCCTGGGATTTTCCTATAGCAGATTTTACGCCAAACCACTGGCTGCCTTGGTGACATACAAAGGAAGGGAGATTTTGATGCATACGAAAGAGATGGTACAAAAGATGAATCTTGAAGTTATTTATGGAGATACAGATTCAATTATGATAAACACCAATAGCACCAATCTGGAAGAAGTATTTAAGTTGGGAAACAAGGTAAAAAGTGAAGTGAATAAGTTGTACAAACTGCTTGAAATAGACATTGATGGGGTTTTCAAGTCTCTGCTACTGCTGAAAAAAAAGAAGTACGCTGCTCTGGTTGTTGAGCCAACGTCGGATGGGAATTATGTCACCAAACAGGAGCTCAAAGGATTAGATATAGTTAGAAGAGATTGGTGTGATCTTGCTAAAGACACTGGAAACTTTGTGATTGGCCAGATTCTTTCTGATCAAAGCCGGGACACTATAGTGGAAAACATTCAGAAGAGGCTGATAGAAATTGGAGAAAATGTGCTAAATGGCAGTGTCCCAGTGAGCCAGTTTGAAATTAACAAGGCATTGACAAAGGATCCCCAGGATTACCCTGATAAAAAAAGCCTACCTCATGTACATGTTGCCCTCTGGATAAATTCTCAAGGAGGCAGAAAGGTGAAAGCTGGAGATACTGTGTCATATGTCATCTGTCAGGATGGATCAAACCTCACTGCAAGTCAGAGGGCCTATGCGCCTGAGCAGCTGCAGAAACAGGATAATCTAACCATTGACACCCAGTACTACCTGGCCCAGCAGATCCACCCAGTCGTGGCTCGGATCTGTGAACCAATAGACGGAATTGATGCTGTCCTCATTGCAACGTGGTTGGGACTTGACCCCACCCAATTTAGAGTTCATCATTATCATAAAGATGAAGAGAATGATGCTCTACTTGGTGGCCCAGCACAGCTCACTGATGAAGAGAAATACAGGGACTGTGAAAGATTCAAATGTCCATGCCCTACATGTGGAACTGAGAATATTTATGATAATGTCTTTGATGGTTCGGGAACAGATATGGAGCCCAGCTTGTATCGTTGCAGTAACATCGATTGTAAGGCTTCACCTCTGACCTTTACAGTACAACTGAGCAACAAATTGATCATGGACATTAGACGTTTCATTAAAAAGTACTATGATGGCTGGTTGATATGTGAAGAGCCAACCTGTCGCAATCGAACTCGTCACCTTCCCCTTCAATTCTCCCGAACTGGGCCTCTTTGCCCAGCCTGCATGAAAGCTACACTTCAACCAGAGTATTCTGACAAGTCCCTGTACACCCAGCTGTGCTTTTACCGGTACATTTTTGATGCGGAGTGTGCACTGGAGAAACTTACTACCGATCATGAGAAAGATAAATTGAAGAAGCAATTTTTTACCCCCAAAGTTCTGCAGGACTACAGAAAACTCAAGAACACAGCAGAGCAATTCTTGTCCCGAAGTGGCTACTCCGAAGTGAATCTGAGCAAACTCTTCGCTGGTTGTGCCGTGAAATCCTAAgcggccgc
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKSGLGSMAPVHGDDCEIGASALSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVED FTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAVTKPNNIKSMFIACAGKKTADKAVDL SKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDDVQVESTEEEQESGAMEFEDGD FDEPMEVEEVDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQY NQPALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKAAYAGGLVLDPKVGFYDKFILLLDF NSLYPSIIQEFNICFTTVQRVASEAQKVTEDGEQEQIPELPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCLG FSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVE PTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWI NSQGGRKVKAGDTVSYVICQDGSNLTASQRAYAPEQLQKQDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDALL GGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKLIMDIRRFIKKYYDGWLICEEPTCRNRTRHLP LQFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVK S*
Price: £110.00
Completion Time: 
66
Wild-type or Mutant: 
New Protein: 
Yes
Low Temp: 
Yes
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

HJURP

cDNA Synonyms: 
FAKTS; hFLEG1; URLC9
DU Number: 
DU65277
Plasmid: 
pcDNA5D FRT/TO mCherry-HJURP
Expressed: 
nCherry-HJURP
Genbank: 
NM_018410.4 (Q8NCD3)
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGCTGGGTACGCTGCGCGCCATGGAGGGCGAGGACGTGGAAGACGACCAGCTGCTGCAGAAGCTCAGGGCCAGTCGCCGCCGCTTCCAGAGGCGCATGCAGCGGCTGATAGAGAAGTACAACCAGCCCTTCGAGGACACCCCGGTGGTGCAAATGGCCACGCTGACCTACGAGACGCCACAGGGATTGAGAATTTGGGGTGGAAGACTAATAAAGGAAAGAAACGAAGGAGAGATCCAGGACTCCTCCATGAAGCCCGCGGACAGGACAGATGGCTCCGTGCAAGCTGCAGCCTGGGGTCCTGAGCTTCCCTCGCACCGCACAGTCCTGGGAGCCGATTCAAAAAGCGGTGAGGTCGATGCCACGTCAGACCAGGAAGAGTCAGTTGCTTGGGCCTTAGCACCTGCAGTGCCTCAAAGCCCTTTGAAAAATGAATTAAGAAGGAAATACTTGACCCAAGTGGATATACTGCTACAAGGTGCAGAGTATTTTGAGTGTGCAGGTAACAGAGCTGGAAGGGATGTACGTGTGACTCCGCTGCCTTCACTGGCCTCACCTGCCGTGCCTGCCCCCGGATACTGCAGTCGTATCTCCAGAAAGAGTCCTGGTGACCCAGCGAAACCAGCTTCATCTCCCAGAGAATGGGATCCTTTGCATCCTTCCTCCACAGACATGGCCTTAGTACCTAGAAATGACAGCCTCTCCCTACAAGAGACCAGTAGCAGCAGCTTCTTAAGCAGCCAGCCCTTTGAAGATGATGACATTTGCAATGTGACCATCAGTGACCTGTACGCAGGGATGCTGCACTCCATGAGCCGGCTGTTGAGCACAAAGCCATCAAGCATCATCTCCACCAAAACGTTCATCATGCAAAACTGGAACTCCAGGAGGAGGCACAGATATAAGAGCAGGATGAACAAAACATATTGCAAAGGAGCCAGACGTTCTCAGAGGAGCTCCAAGGAGAACTTCATACCCTGCTCTGAGCCTGTGAAAGGGACAGGGGCATTAAGAGATTGCAAGAACGTATTAGATGTTTCTTGCCGTAAGACAGGTTTAAAATTGGAAAAAGCTTTTCTTGAAGTCAACAGACCCCAAATCCATAAGTTAGATCCAAGTTGGAAGGAGCGCAAAGTGACACCCTCGAAGTATTCTTCCTTGATTTACTTCGACTCCAGTGCAACATATAATCTTGATGAGGAAAATAGATTTAGGACATTAAAATGGTTAATTTCTCCTGTAAAAATAGTTTCCAGACCAACAATACGACAGGGCCATGGAGAGAACCGTCAGAGGGAGATTGAAATCCGATTTGATCAGCTTCATCGGGAATATTGCCTGAGTCCCAGGAACCAGCCTCGCCGGATGTGCCTCCCGGACTCCTGGGCCATGAACATGTACAGAGGGGGTCCTGCGAGTCCTGGTGGCCTTCAGGGCTTAGAAACCCGCAGGCTGAGTTTACCTTCCAGCAAAGCAAAAGCAAAAAGTTTAAGTGAGGCTTTTGAAAACCTAGGCAAAAGATCTCTGGAAGCAGGTAGGTGCCTGCCCAAGAGCGATTCATCTTCATCACTTCCAAAGACCAACCCCACACACAGCGCAACTCGCCCGCAGCAGACATCTGACCTTCACGTTCAGGGAAATAGTTCTGGAATATTTAGAAAGTCAGTGTCACCCAGCAAAACTCTTTCAGTCCCAGATAAAGAAGTGCCAGGCCACGGAAGGAATCGTTACGATGAAATTAAAGAAGAATTTGACAAGCTTCATCAAAAGTATTGCCTCAAATCTCCTGGGCAGATGACAGTGCCTTTATGTATTGGAGTGTCTACAGATAAAGCAAGTATGGAAGTTCGATATCAAACAGAAGGCTTCTTAGGAAAATTAAATCCAGACCCTCACTTCCAGGGTTTCCAGAAGTTGCCATCATCACCCCTGGGGTGCAGAAAAAGTCTACTGGGCTCAACTGCAATTGAGGCTCCTTCATCTACATGTGTTGCTCGTGCCATCACGAGGGATGGCACGAGGGACCATCAGTTCCCTGCAAAAAGACCCAGGCTATCAGAACCCCAGGGCTCCGGACGCCAGGGCAATTCCCTGGGTGCCTCAGATGGGGTGGACAACACCGTCAGACCGGGAGACCAGGGCAGCTCTTCACAGCCCAACTCAGAAGAGAGAGGAGAGAACACGTCTTACAGGATGGAAGAGAAAAGTGATTTCATGCTAGAAAAATTGGAAACTAAAAGTGTGTAGCGGCCGC
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA SSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKSGLGSPGEFMLGTL RAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATL TYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPS HRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVD ILLQGAEYFECAGNRAGRDVRVTPLPSLASPAVPAPGYCSRISRKSPGDP AKPASSPREWDPLHPSSTDMALVPRNDSLSLQETSSSSFLSSQPFEDDDI CNVTISDLYAGMLHSMSRLLSTKPSSIISTKTFIMQNWNSRRRHRYKSRM NKTYCKGARRSQRSSKENFIPCSEPVKGTGALRDCKNVLDVSCRKTGLKL EKAFLEVNRPQIHKLDPSWKERKVTPSKYSSLIYFDSSATYNLDEENRFR TLKWLISPVKIVSRPTIRQGHGENRQREIEIRFDQLHREYCLSPRNQPRR MCLPDSWAMNMYRGGPASPGGLQGLETRRLSLPSSKAKAKSLSEAFENLG KRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHVQGNSSGIFRKS VSPSKTLSVPDKEVPGHGRNRYDEIKEEFDKLHQKYCLKSPGQMTVPLCI GVSTDKASMEVRYQTEGFLGKLNPDPHFQGFQKLPSSPLGCRKSLLGSTA IEAPSSTCVARAITRDGTRDHQFPAKRPRLSEPQGSGRQGNSLGASDGVD NTVRPGDQGSSSQPNSEERGENTSYRMEEKSDFMLEKLETKSV*
Price: £110.00
Completion Time: 
10
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

VDAC1

cDNA Synonyms: 
PORIN; VDAC-1
DU Number: 
DU67175
Plasmid: 
pBabeD hygro mCherry GFP VDAC1
Expressed: 
mCherry GFP VDAC1
Genbank: 
NM_003374.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTGTGCCACCCACGTATGCCGATCTTGGCAAATCTGCCAGGGATGTCTTCACCAAGGGCTATGGATTTGGCTTAATAAAGCTTGATTTGAAAACAAAATCTGAGAATGGATTGGAATTTACAAGCTCAGGCTCAGCCAACACTGAGACCACCAAAGTGACGGGCAGTCTGGAAACCAAGTACAGATGGACTGAGTACGGCCTGACGTTTACAGAGAAATGGAATACCGACAATACACTAGGCACCGAGATTACTGTGGAAGATCAGCTTGCACGTGGACTGAAGCTGACCTTCGATTCATCCTTCTCACCTAACACTGGGAAAAAAAATGCTAAAATCAAGACAGGGTACAAGCGGGAGCACATTAACCTGGGCTGCGACATGGATTTCGACATTGCTGGGCCTTCCATCCGGGGTGCTCTGGTGCTAGGTTACGAGGGCTGGCTGGCCGGCTACCAGATGAATTTTGAGACTGCAAAATCCCGAGTGACCCAGAGCAACTTTGCAGTTGGCTACAAGACTGATGAATTCCAGCTTCACACTAATGTGAATGACGGGACAGAGTTTGGCGGCTCCATTTACCAGAAAGTGAACAAGAAGTTGGAGACCGCTGTCAATCTTGCCTGGACAGCAGGAAACAGTAACACGCGCTTCGGAATAGCAGCCAAGTATCAGATTGACCCTGACGCCTGCTTCTCGGCTAAAGTGAACAACTCCAGCCTGATAGGTTTAGGATACACTCAGACTCTAAAGCCAGGTATTAAACTGACACTGTCAGCTCTTCTGGATGGCAAGAACGTCAATGCTGGTGGCCACAAGCTTGGTCTAGGACTGGAATTTCAAGCATAAGCGGCCGC
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKGGGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPT LVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKN GIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGSMAVPPTYADLGKSARDVFT KGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYK REHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRF GIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA*
Price: £110.00
Completion Time: 
16
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R109
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

mCherry

DU Number: 
DU66077
Plasmid: 
p416 GDP mCherry del 24-37
Expressed: 
mCherry del 24-37
Vector Type: 
Yeast
Tag: 
Sequence of Insert: 
GGATCCATGGTGAGCAAGGGCGAGGAGGATAACATGGCCATCATCAAGGAGTTCATGCGCTTCAAGGTGCACATGGAGGAGGGCCGCCCCTACGAGGGCACCCAGACCGCCAAGCTGAAGGTGACCAAGGGTGGCCCCCTGCCCTTCGCCTGGGACATCCTGTCCCCTCAGTTCATGTACGGCTCCAAGGCCTACGTGAAGCACCCCGCCGACATCCCCGACTACTTGAAGCTGTCCTTCCCCGAGGGCTTCAAGTGGGAGCGCGTGATGAACTTCGAGGACGGCGGCGTGGTGACCGTGACCCAGGACTCCTCCCTGCAGGACGGCGAGTTCATCTACAAGGTGAAGCTGCGCGGCACCAACTTCCCCTCCGACGGCCCCGTAATGCAGAAGAAGACCATGGGCTGGGAGGCCTCCTCCGAGCGGATGTACCCCGAGGACGGCGCCCTGAAGGGCGAGATCAAGCAGAGGCTGAAGCTGAAGGACGGCGGCCACTACGACGCTGAGGTCAAGACCACCTACAAGGCCAAGAAGCCCGTGCAGCTGCCCGGCGCCTACAACGTCAACATCAAGTTGGACATCACCTCCCACAACGAGGACTACACCATCGTGGAACAGTACGAACGCGCCGAGGGCCGCCACTCCACCGGCGGCATGGACGAGCTGTACAAGTAGAAGCTT
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK*
Price: £110.00
Completion Time: 
374
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R109
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

mCherry

DU Number: 
DU66076
Plasmid: 
p416 GDP mCherry
Expressed: 
mCherry
Vector Type: 
Yeast
Tag: 
Sequence of Insert: 
GGATCCATGGTGAGCAAGGGCGAGGAGGATAACATGGCCATCATCAAGGAGTTCATGCGCTTCAAGGTGCACATGGAGGGCTCCGTGAACGGCCACGAGTTCGAGATCGAGGGCGAGGGCGAGGGCCGCCCCTACGAGGGCACCCAGACCGCCAAGCTGAAGGTGACCAAGGGTGGCCCCCTGCCCTTCGCCTGGGACATCCTGTCCCCTCAGTTCATGTACGGCTCCAAGGCCTACGTGAAGCACCCCGCCGACATCCCCGACTACTTGAAGCTGTCCTTCCCCGAGGGCTTCAAGTGGGAGCGCGTGATGAACTTCGAGGACGGCGGCGTGGTGACCGTGACCCAGGACTCCTCCCTGCAGGACGGCGAGTTCATCTACAAGGTGAAGCTGCGCGGCACCAACTTCCCCTCCGACGGCCCCGTAATGCAGAAGAAGACCATGGGCTGGGAGGCCTCCTCCGAGCGGATGTACCCCGAGGACGGCGCCCTGAAGGGCGAGATCAAGCAGAGGCTGAAGCTGAAGGACGGCGGCCACTACGACGCTGAGGTCAAGACCACCTACAAGGCCAAGAAGCCCGTGCAGCTGCCCGGCGCCTACAACGTCAACATCAAGTTGGACATCACCTCCCACAACGAGGACTACACCATCGTGGAACAGTACGAACGCGCCGAGGGCCGCCACTCCACCGGCGGCATGGACGAGCTGTACAAGTAGAAGCTT
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK*
Price: £110.00
Completion Time: 
374
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R109
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

RNASEH1

DU Number: 
DU67022
Plasmid: 
pcDNA5D FRT/TO mCherry RNASEH1
Expressed: 
mCherry RNASEH1
Genbank: 
CR541820.1 with residue changes K33R and I136M (common variants)
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGAGCTGGCTTCTGTTCCTGGCCCACAGAGTCGCCTTGGCCGCCTTGCCCTGCCGCCGCGGCTCTCGCGGGTTCGGGATGTTCTATGCCGTGAGGAGGGGCCGCAAGACCGGGGTCTTTCTGACCTGGAATGAGTGCAGAGCACAGGTGGACCGGTTTCCTGCTGCCAGATTTAAGAAGTTTGCCACAGAGGATGAGGCCTGGGCCTTTGTCAGGAAATCTGCAAGCCCGGAAGTTTCAGAAGGGCATGAAAATCAACATGGACAAGAATCGGAGGCGAAAGCCAGCAAGCGACTCCGTGAGCCACTGGATGGAGATGGACATGAAAGCGCAGAGCCGTATGCAAAGCACATGAAGCCGAGCGTGGAGCCGGCGCCTCCAGTTAGCAGAGACACGTTTTCCTACATGGGAGACTTCGTCGTCGTCTACACTGATGGCTGCTGCTCCAGTAATGGGCGTAGAAGGCCGCGAGCAGGAATCGGCGTTTACTGGGGGCCAGGCCATCCTTTAAATGTAGGCATTAGACTTCCTGGGCGGCAGACAAACCAAAGAGCGGAAATTCATGCAGCCTGCAAAGCCATTGAACAAGCAAAGACTCAAAACATCAATAAACTGGTTCTGTATACAGACAGTATGTTTACGATAAATGGTATAACTAACTGGGTTCAAGGTTGGAAGAAAAATGGGTGGAAGACAAGTGCAGGGAAAGAGGTGATCAACAAAGAGGACTTTGTGGCACTGGAGAGGCTTACCCAGGGGATGGACATTCAGTGGATGCATGTTCCTGGTCATTCGGGATTTATAGGCAATGAAGAAGCTGACAGATTAGCCAGAGAAGGAGCTAAACAATCGGAAGACTGAGCGGCCGC
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKSGLGSMSWLLFLAHRVALAALPCRRGSRGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFK KFATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRLREPLDGDGHESAEPYAKHMKPSVEPAPPVSRDTFSYMGDFVVVYTDGCCSSNGRRRPRAG IGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWM HVPGHSGFIGNEEADRLAREGAKQSED*
Price: £110.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

mcherry PEX26 S245-P274

DU Number: 
DU65159
Plasmid: 
pQCXIP mcherry-PEX26 S245-P274
Expressed: 
mcherry-PEX26 S245-P274
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
gGATCTATGGTGAGCAAGGGCGAGGAGGATAACATGGCCATCATCAAGGA GTTCATGCGCTTCAAGGTGCACATGGAGGGCTCCGTGAACGGCCACGAGT TCGAGATCGAGGGCGAGGGCGAGGGCCGCCCCTACGAGGGCACCCAGACC GCCAAGCTGAAGGTGACCAAGGGTGGCCCCCTGCCCTTCGCCTGGGACAT CCTGTCCCCTCAGTTCATGTACGGCTCCAAGGCCTACGTGAAGCACCCCG CCGACATCCCCGACTACTTGAAGCTGTCCTTCCCCGAGGGCTTCAAGTGG GAGCGCGTGATGAACTTCGAGGACGGCGGCGTGGTGACCGTGACCCAGGA CTCCTCCCTGCAGGACGGCGAGTTCATCTACAAGGTGAAGCTGCGCGGCA CCAACTTCCCCTCCGACGGCCCCGTAATGCAGAAGAAGACCATGGGCTGG GAGGCCTCCTCCGAGCGGATGTACCCCGAGGACGGCGCCCTGAAGGGCGA GATCAAGCAGAGGCTGAAGCTGAAGGACGGCGGCCACTACGACGCTGAGG TCAAGACCACCTACAAGGCCAAGAAGCCCGTGCAGCTGCCCGGCGCCTAC AACGTCAACATCAAGTTGGACATCACCTCCCACAACGAGGACTACACCAT CGTGGAACAGTACGAACGCGCCGAGGGCCGCCACTCCACCGGCGGCATGG ACGAGCTGTACAAGAGATCCAGCCACTTCTTTTCTCTGCCCTTCAAAAAG AGTCTCCTGGCTGCCTTGATCCTCTGTCTCCTGGTGGTGAGATTTGATCC AGCTTCCCCTTAGGAATTC
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA SSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKRSSHFFSLPFKKSL LAALILCLLVVRFDPASP*
Price: £110.00
Completion Time: 
50
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Cost Centre: 
357.801626.R103
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.