mCherry

TBC1D9B

cDNA Synonyms: 
GRAMD9B
DU Number: 
DU72812
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT TO mCherry TBC1D9B ISO2
Expressed: 
mCherry TBC1D9B ISO2
Genbank: 
NM_015043.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
51
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
118167.D.C001.1650.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

TBC1D9B

cDNA Synonyms: 
GRAMD9B
DU Number: 
DU72700
Cost of Production: 
200.00
Plasmid: 
pcDNA5D FRT/TO TBC1D9B mCherry (ISOFORM 2)
Expressed: 
TBC1D9B mCherry
Genbank: 
NM_015043.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MWLSPEEVLVANALWVTERANPFFVLQRRRGHGRGGGLTGLLVGTLDVVLDSSARVAPYRILHQTQDSQVYWTVACGSSRKEITKHWEWLENNLLQTLSIFDSEEDITTFVKGKIHGIIAEENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVSLVVQWVDITRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKLMEQLANLAMRQLLDSEGFLEDKALPRPIRPHRNISALKRDLDARAKNECYRATFRLPRDERLDGHTSCTLWTPFNKLHIPGQMFISNNYICFASKEEDACHLIIPLREVTIVEKADSSSVLPSPLSISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQPGSIGSRKASVVDPSTESSPAPQEGSEQPASPASPLSSRQSFCAQEAPTASQGLLKLFQKNSPMEDLGAKGAKEKMKEESWHIHFFEYGRGVCMYRTAKTRALVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVEKSTGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGIFEELTRDFLPQLSEKMQDLGVISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANMEQLLGCSDEGEAMTMLGRYLDNVVNKQSVSPPIPHLRALLSSSDDPPAEVDIFELLKVSYEKFSSLRAEDIEQMRFKQRLKVIQSLEDTAKRSVVRAIPVDIGFSIEELEDLYMVFKAKHLASQYWGCSRTMAGRRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPLLAGRMFRLLDENKDSLINFKEFVTGMSGMYHGDLTEKLKVLYKLHLPPALSPEEAESALEAAHYFTEDSSSEEALPQEEQEGSGSEERGEEKGTSSPDYRHYLRMWAKEKEAQKETIKDLPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKKFSARTGRKPRDCATEEDEPPAPELHQDAARELQPPAAGDPQAKAGGDTHLGTAPQESQVVVEGGSGEGQGSPSQLLSDDETKDDMSMSSYSVVSTGSLQCEDLADDTVLVGGEACSPTARIGGTVDTDWCISFEQILASILTESVLVNFFEKRVDIGLKIKDQKKVERQFSTASDHEQPGVSGAAAMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKSGL*
Price: £125.00
Completion Time: 
14
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
118167.D.C001.1650.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

JIP4

DU Number: 
DU72612
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO JIP4 mCherry
Expressed: 
JIP4 mCherry
Genbank: 
NM_001130528.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
6
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
118167.D.C001.1650.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

SLC6A6

cDNA Synonyms: 
HTRDC, TAUT
DU Number: 
DU72042
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO mCherry SLC6A6
Expressed: 
mCherry SLC6A6
Genbank: 
NM_003043.6
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
51
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
118922.D.C001.2528.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

SLC6A6

DU Number: 
DU72029
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO SLC6A6 mCherry
Expressed: 
SLC6A6 mCherry
Genbank: 
SLC6A6
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
37
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
118922.D.C001.2528.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

SNX9

cDNA Synonyms: 
SDP1; SH3PX1; SH3PXD3A; WISP
DU Number: 
DU61257
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO mCherry SNX9
Expressed: 
mCherry SNX9
Genbank: 
NM_016224.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCCACCAAGGCTCGGGTTATGTATGATTTTGCTGCTGAACCTGGAAATAATGAACTGACGGTTAATGAAGGAGAAATCATCACAATCACAAATCCGGATGTAGGTGGAGGATGGCTGGAAGGAAGAAACATCAAAGGAGAACGAGGGCTGGTTCCCACAGACTACGTTGAAATTTTACCCAGTGATGGAAAAGATCAATTTTCTTGTGGAAATTCAGTGGCTGACCAAGCCTTCCTTGATTCTCTCTCAGCCAGCACAGCTCAGGCCAGTTCGTCGGCTGCCAGCAACAATCACCAGGTTGGCAGTGGCAATGACCCCTGGTCAGCCTGGAGTGCCTCCAAATCTGGGAACTGGGAAAGCTCAGAAGGCTGGGGGGCCCAGCCAGAGGGGGCTGGAGCCCAAAGAAACACAAACACTCCCAACAACTGGGACACTGCCTTCGGCCACCCCCAGGCCTACCAAGGACCAGCAACTGGTGATGATGATGACTGGGATGAAGACTGGGATGGGCCCAAATCCTCTTCCTACTTTAAGGATTCAGAGTCAGCTGATGCAGGCGGCGCTCAGCGAGGAAACAGTCGTGCTAGTTCCTCATCCATGAAAATTCCCCTTAACAAATTTCCTGGATTTGCGAAACCTGGCACGGAACAGTATTTGTTGGCCAAACAACTAGCAAAACCCAAAGAGAAAATTCCCATCATTGTTGGAGATTATGGCCCAATGTGGGTTTATCCTACCTCTACTTTTGACTGTGTGGTAGCAGATCCCAGGAAAGGCTCCAAAATGTATGGTCTAAAGAGCTACATCGAATATCAGCTAACACCTACTAACACTAATCGATCTGTAAACCACAGGTATAAGCACTTTGACTGGTTATATGAGCGTCTCCTGGTTAAGTTTGGGTCAGCCATTCCAATCCCTTCTCTTCCAGACAAACAAGTCACAGGCCGCTTTGAAGAGGAATTTATCAAAATGCGCATGGAGAGACTTCAGGCCTGGATGACCAGGATGTGTCGCCATCCAGTAATCTCAGAAAGTGAAGTTTTCCAGCAGTTCCTAAATTTCCGAGATGAGAAGGAATGGAAAACTGGAAAGAGGAAGGCCGAGAGAGATGAGCTGGCGGGAGTCATGATATTTTCCACCATGGAACCAGAGGCACCTGACTTGGACTTAGTAGAAATAGAGCAGAAGTGCGAGGCTGTGGGGAAGTTCACCAAGGCCATGGATGACGGCGTGAAGGAGCTGCTGACGGTGGGGCAGGAGCACTGGAAGCGCTGCACGGGCCCATTACCCAAGGAATATCAGAAGATAGGAAAGGCCTTGCAGAGTTTGGCCACAGTGTTCAGTTCCAGTGGCTATCAAGGTGAAACAGATCTCAATGATGCAATAACAGAAGCAGGAAAGACTTATGAAGAAATTGCCAGTCTCGTGGCAGAACAGCCAAAGAAAGATCTCCATTTCCTGATGGAATGTAATCACGAGTATAAAGGTTTTCTTGGCTGCTTCCCTGACATCATTGGCACTCACAAGGGAGCAATAGAAAAAGTGAAAGAAAGTGACAAACTAGTTGCAACAAGTAAAATCACCCTACAAGACAAACAGAACATGGTGAAGAGAGTCAGCATCATGTCTTACGCGTTGCAAGCTGAGATGAATCACTTTCACAGTAACCGGATCTATGATTACAACAGTGTCATCCGCCTGTACCTGGAGCAGCAAGTGCAATTTTACGAAACGATTGCAGAAAAGCTGAGGCAGGCCCTCAGCCGCTTTCCAGTGATGTAGCGGCCGC
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKSGLGSMATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEI LPSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPAT GDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRK GSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDE KEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETD LNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNR IYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM*
Price: £125.00
Completion Time: 
11
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811497.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No

mCherry/GFP

DU Number: 
DU67583
Plasmid: 
pBabe hygro mCherry GFP SKL (Deposited by Lea Wilhelm)
Expressed: 
mCherry GFP SKL
Genbank: 
-
Vector Type: 
Mammalian
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKGGGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPT LVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKN GIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSKL*
Price: £125.00
Completion Time: 
0
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

FIS1

cDNA Synonyms: 
mitochondrial fission protein 1
DU Number: 
DU65472
Cost of Production: 
80.00
Plasmid: 
pBabe puro mCherry-Fis aa101-152 (end)
Expressed: 
mCherry Fis1 101-152
Genbank: 
NP_057152.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCGAGCCCCAGAACAACCAGGCCAAGGAACTGGAGCGGCTCATTGACAAGGCCATGAAGAAAGATGGACTCGTGGGCATGGCCATCGTGGGAGGCATGGCCCTGGGTGTGGCGGGACTGGCCGGACTCATCGGACTTGCTGTGTCCAAGTCCAAATCCTGAGCGGCCGC
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA SSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKGGGSEPQNNQAKEL ERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS*
Price: £125.00
Completion Time: 
15
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

POLA1

cDNA Synonyms: 
NSX, POLA, p180
DU Number: 
DU64729
Plasmid: 
pcDNA5 frtTO mCherry POLA1 (missing 1086-2309 bp)
Expressed: 
mCherry-POLA1 (delta 1086-2309 bp)
Genbank: 
NM_016937.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
agatctATGGCACCTGTGCACGGCGACGACTGTGAGATAGGGGCGAGTGCTCTGTCAGATTCAGGGAGTTTTGTATCTTCTCGAGCCCGGCGAGAAAAAAAATCAAAGAAGGGGCGCCAAGAAGCCCTAGAAAGACTGAAAAAGGCTAAAGCTGGTGAGAAGTATAAATATGAAGTCGAGGACTTCACAGGTGTTTATGAAGAAGTTGATGAAGAACAGTATTCGAAGCTGGTTCAGGCACGCCAGGATGATGACTGGATTGTGGATGATGATGGTATTGGCTATGTGGAAGATGGCCGAGAGATTTTTGATGATGACCTTGAAGATGATGCCCTTGATGCTGATGAGAAAGGAAAAGATGGTAAAGCACGCAATAAAGACAAGAGGAATGTAAAGAAGCTCGCAGTGACAAAACCGAACAACATTAAGTCAATGTTCATTGCTTGTGCTGGAAAGAAAACTGCAGATAAAGCTGTAGACTTGTCCAAGGATGGTCTGCTAGGTGACATTCTACAGGATCTTAACACTGAGACACCTCAAATAACTCCACCACCTGTAATGATACTGAAGAAGAAAAGATCCATTGGAGCTTCACCGAATCCTTTCTCTGTGCACACCGCCACGGCAGTTCCTTCAGGAAAAATTGCTTCCCCTGTCTCCAGAAAGGAGCCTCCATTAACTCCTGTTCCTCTTAAACGTGCTGAATTTGCTGGCGATGATGTACAGGTCGAGAGTACAGAAGAAGAGCAGGAGTCAGGGGCAATGGAGTTTGAAGATGGTGACTTTGATGAGCCCATGGAAGTTGAAGAGGTGGACCTGGAGCCTATGGCTGCCAAGGCTTGGGACAAAGAGAGTGAGCCAGCAGAGGAAGTGAAACAAGAGGCGGATTCTGGGAAAGGGACCGTGTCCTACTTAGGAAGTTTTCTCCCGGATGTCTCTTGTTGGGACATTGATCAAGAAGGTGATAGCAGTTTCTCAGTGCAAGAAGTTCAAGTGGATTCCAGTCACCTCCCATTGGTAAAAGGGGCAGATGAGGAACAAGTATTCCACTTTTATTGGTTGGATGCTTATGAGGATCAGTACAACCAACCAGCATTGCAGATCACTAACATCGCTGGGAACATTATGTCCAGGACGCTGATGGGTGGACGATCCGAGCGTAACGAGTTCTTGTTGCTTCATGCATTTTACGAAAACAACTATATTGTGCCTGACAAGCAGATTTTCAGAAAGCCTCAGCAAAAACTGGGAGATGAAGATGAAGAAATTGATGGAGATACCAATAAATACAAGAAAGGACGTAAGAAAGCAGCTTATGCTGGAGGCTTGGTTTTGGACCCCAAAGTTGGTTTTTATGATAAGTTCATTTTGCTTCTGGACTTCAACAGTCTATATCCTTCCATCATTCAGGAATTTAACATTTGTTTTACAACAGTACAAAGAGTTGCTTCAGAGGCACAGAAAGTTACAGAGGATGGAGAACAAGAACAGATCCCTGAGTTGCCAGATCCAAGCTTAGAAATGGGCATTTTGCCCAGAGAGATCCGGAAACTGGTAGAACGGAGAAAACAAGTCAAACAGCTAATGAAACAGCAAGACTTAAATCCAGACCTTATTCTTCAGTATGACATTCGACAGAAGGCTTTGAAGCTCACAGCGAACAGTATGTATGGTTGCCTGGGATTTTCCTATAGCAGATTTTACGCCAAACCACTGGCTGCCTTGGTGACATACAAAGGAAGGGAGATTTTGATGCATACGAAAGAGATGGTACAAAAGATGAATCTTGAAGTTATTTATGGAGATACAGATTCAATTATGATAAACACCAATAGCACCAATCTGGAAGAAGTATTTAAGTTGGGAAACAAGGTAAAAAGTGAAGTGAATAAGTTGTACAAACTGCTTGAAATAGACATTGATGGGGTTTTCAAGTCTCTGCTACTGCTGAAAAAAAAGAAGTACGCTGCTCTGGTTGTTGAGCCAACGTCGGATGGGAATTATGTCACCAAACAGGAGCTCAAAGGATTAGATATAGTTAGAAGAGATTGGTGTGATCTTGCTAAAGACACTGGAAACTTTGTGATTGGCCAGATTCTTTCTGATCAAAGCCGGGACACTATAGTGGAAAACATTCAGAAGAGGCTGATAGAAATTGGAGAAAATGTGCTAAATGGCAGTGTCCCAGTGAGCCAGTTTGAAATTAACAAGGCATTGACAAAGGATCCCCAGGATTACCCTGATAAAAAAAGCCTACCTCATGTACATGTTGCCCTCTGGATAAATTCTCAAGGAGGCAGAAAGGTGAAAGCTGGAGATACTGTGTCATATGTCATCTGTCAGGATGGATCAAACCTCACTGCAAGTCAGAGGGCCTATGCGCCTGAGCAGCTGCAGAAACAGGATAATCTAACCATTGACACCCAGTACTACCTGGCCCAGCAGATCCACCCAGTCGTGGCTCGGATCTGTGAACCAATAGACGGAATTGATGCTGTCCTCATTGCAACGTGGTTGGGACTTGACCCCACCCAATTTAGAGTTCATCATTATCATAAAGATGAAGAGAATGATGCTCTACTTGGTGGCCCAGCACAGCTCACTGATGAAGAGAAATACAGGGACTGTGAAAGATTCAAATGTCCATGCCCTACATGTGGAACTGAGAATATTTATGATAATGTCTTTGATGGTTCGGGAACAGATATGGAGCCCAGCTTGTATCGTTGCAGTAACATCGATTGTAAGGCTTCACCTCTGACCTTTACAGTACAACTGAGCAACAAATTGATCATGGACATTAGACGTTTCATTAAAAAGTACTATGATGGCTGGTTGATATGTGAAGAGCCAACCTGTCGCAATCGAACTCGTCACCTTCCCCTTCAATTCTCCCGAACTGGGCCTCTTTGCCCAGCCTGCATGAAAGCTACACTTCAACCAGAGTATTCTGACAAGTCCCTGTACACCCAGCTGTGCTTTTACCGGTACATTTTTGATGCGGAGTGTGCACTGGAGAAACTTACTACCGATCATGAGAAAGATAAATTGAAGAAGCAATTTTTTACCCCCAAAGTTCTGCAGGACTACAGAAAACTCAAGAACACAGCAGAGCAATTCTTGTCCCGAAGTGGCTACTCCGAAGTGAATCTGAGCAAACTCTTCGCTGGTTGTGCCGTGAAATCCTAAgcggccgc
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKSGLGSMAPVHGDDCEIGASALSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVED FTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAVTKPNNIKSMFIACAGKKTADKAVDL SKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDDVQVESTEEEQESGAMEFEDGD FDEPMEVEEVDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQY NQPALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKAAYAGGLVLDPKVGFYDKFILLLDF NSLYPSIIQEFNICFTTVQRVASEAQKVTEDGEQEQIPELPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCLG FSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVE PTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWI NSQGGRKVKAGDTVSYVICQDGSNLTASQRAYAPEQLQKQDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDALL GGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKLIMDIRRFIKKYYDGWLICEEPTCRNRTRHLP LQFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVK S*
Price: £125.00
Completion Time: 
66
Wild-type or Mutant: 
New Protein: 
Yes
Low Temp: 
Yes
Hidden Project: 
No
Cost Centre: 
357.811395.R103
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted

HJURP

cDNA Synonyms: 
FAKTS; hFLEG1; URLC9
DU Number: 
DU65277
Plasmid: 
pcDNA5D FRT/TO mCherry-HJURP
Expressed: 
nCherry-HJURP
Genbank: 
NM_018410.4 (Q8NCD3)
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GAATTCATGCTGGGTACGCTGCGCGCCATGGAGGGCGAGGACGTGGAAGACGACCAGCTGCTGCAGAAGCTCAGGGCCAGTCGCCGCCGCTTCCAGAGGCGCATGCAGCGGCTGATAGAGAAGTACAACCAGCCCTTCGAGGACACCCCGGTGGTGCAAATGGCCACGCTGACCTACGAGACGCCACAGGGATTGAGAATTTGGGGTGGAAGACTAATAAAGGAAAGAAACGAAGGAGAGATCCAGGACTCCTCCATGAAGCCCGCGGACAGGACAGATGGCTCCGTGCAAGCTGCAGCCTGGGGTCCTGAGCTTCCCTCGCACCGCACAGTCCTGGGAGCCGATTCAAAAAGCGGTGAGGTCGATGCCACGTCAGACCAGGAAGAGTCAGTTGCTTGGGCCTTAGCACCTGCAGTGCCTCAAAGCCCTTTGAAAAATGAATTAAGAAGGAAATACTTGACCCAAGTGGATATACTGCTACAAGGTGCAGAGTATTTTGAGTGTGCAGGTAACAGAGCTGGAAGGGATGTACGTGTGACTCCGCTGCCTTCACTGGCCTCACCTGCCGTGCCTGCCCCCGGATACTGCAGTCGTATCTCCAGAAAGAGTCCTGGTGACCCAGCGAAACCAGCTTCATCTCCCAGAGAATGGGATCCTTTGCATCCTTCCTCCACAGACATGGCCTTAGTACCTAGAAATGACAGCCTCTCCCTACAAGAGACCAGTAGCAGCAGCTTCTTAAGCAGCCAGCCCTTTGAAGATGATGACATTTGCAATGTGACCATCAGTGACCTGTACGCAGGGATGCTGCACTCCATGAGCCGGCTGTTGAGCACAAAGCCATCAAGCATCATCTCCACCAAAACGTTCATCATGCAAAACTGGAACTCCAGGAGGAGGCACAGATATAAGAGCAGGATGAACAAAACATATTGCAAAGGAGCCAGACGTTCTCAGAGGAGCTCCAAGGAGAACTTCATACCCTGCTCTGAGCCTGTGAAAGGGACAGGGGCATTAAGAGATTGCAAGAACGTATTAGATGTTTCTTGCCGTAAGACAGGTTTAAAATTGGAAAAAGCTTTTCTTGAAGTCAACAGACCCCAAATCCATAAGTTAGATCCAAGTTGGAAGGAGCGCAAAGTGACACCCTCGAAGTATTCTTCCTTGATTTACTTCGACTCCAGTGCAACATATAATCTTGATGAGGAAAATAGATTTAGGACATTAAAATGGTTAATTTCTCCTGTAAAAATAGTTTCCAGACCAACAATACGACAGGGCCATGGAGAGAACCGTCAGAGGGAGATTGAAATCCGATTTGATCAGCTTCATCGGGAATATTGCCTGAGTCCCAGGAACCAGCCTCGCCGGATGTGCCTCCCGGACTCCTGGGCCATGAACATGTACAGAGGGGGTCCTGCGAGTCCTGGTGGCCTTCAGGGCTTAGAAACCCGCAGGCTGAGTTTACCTTCCAGCAAAGCAAAAGCAAAAAGTTTAAGTGAGGCTTTTGAAAACCTAGGCAAAAGATCTCTGGAAGCAGGTAGGTGCCTGCCCAAGAGCGATTCATCTTCATCACTTCCAAAGACCAACCCCACACACAGCGCAACTCGCCCGCAGCAGACATCTGACCTTCACGTTCAGGGAAATAGTTCTGGAATATTTAGAAAGTCAGTGTCACCCAGCAAAACTCTTTCAGTCCCAGATAAAGAAGTGCCAGGCCACGGAAGGAATCGTTACGATGAAATTAAAGAAGAATTTGACAAGCTTCATCAAAAGTATTGCCTCAAATCTCCTGGGCAGATGACAGTGCCTTTATGTATTGGAGTGTCTACAGATAAAGCAAGTATGGAAGTTCGATATCAAACAGAAGGCTTCTTAGGAAAATTAAATCCAGACCCTCACTTCCAGGGTTTCCAGAAGTTGCCATCATCACCCCTGGGGTGCAGAAAAAGTCTACTGGGCTCAACTGCAATTGAGGCTCCTTCATCTACATGTGTTGCTCGTGCCATCACGAGGGATGGCACGAGGGACCATCAGTTCCCTGCAAAAAGACCCAGGCTATCAGAACCCCAGGGCTCCGGACGCCAGGGCAATTCCCTGGGTGCCTCAGATGGGGTGGACAACACCGTCAGACCGGGAGACCAGGGCAGCTCTTCACAGCCCAACTCAGAAGAGAGAGGAGAGAACACGTCTTACAGGATGGAAGAGAAAAGTGATTTCATGCTAGAAAAATTGGAAACTAAAAGTGTGTAGCGGCCGC
Amino Acid Sequence: 
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA SSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKSGLGSPGEFMLGTL RAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATL TYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPS HRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVD ILLQGAEYFECAGNRAGRDVRVTPLPSLASPAVPAPGYCSRISRKSPGDP AKPASSPREWDPLHPSSTDMALVPRNDSLSLQETSSSSFLSSQPFEDDDI CNVTISDLYAGMLHSMSRLLSTKPSSIISTKTFIMQNWNSRRRHRYKSRM NKTYCKGARRSQRSSKENFIPCSEPVKGTGALRDCKNVLDVSCRKTGLKL EKAFLEVNRPQIHKLDPSWKERKVTPSKYSSLIYFDSSATYNLDEENRFR TLKWLISPVKIVSRPTIRQGHGENRQREIEIRFDQLHREYCLSPRNQPRR MCLPDSWAMNMYRGGPASPGGLQGLETRRLSLPSSKAKAKSLSEAFENLG KRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHVQGNSSGIFRKS VSPSKTLSVPDKEVPGHGRNRYDEIKEEFDKLHQKYCLKSPGQMTVPLCI GVSTDKASMEVRYQTEGFLGKLNPDPHFQGFQKLPSSPLGCRKSLLGSTA IEAPSSTCVARAITRDGTRDHQFPAKRPRLSEPQGSGRQGNSLGASDGVD NTVRPGDQGSSSQPNSEERGENTSYRMEEKSDFMLEKLETKSV*
Price: £125.00
Completion Time: 
10
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.