HALO

TMEM55B

cDNA Synonyms: 
C14orf9; PIP4P1
DU Number: 
DU61989
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO Halo 3C TMEM55B K141E K155E iso 2
Expressed: 
Halo 3C TMEM55B K141E K155E iso 2
Genbank: 
NM_001100814.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MAEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEV VLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDRE PLWRFPNELPIAGEPANIVALVEEYMDWLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEISGLEV LFQGPGSMAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAGKHAPPQAFPPFPEGHPAVLPGEDPPPYSPLTSPDSGSAPMITCRV CQSLINVEGKMHQHVVKCGVCNEATPIKNAPPGKKYVRCPCNCLLICEVTSQRIACPRPYCERIINLGPVHPGPLSPEPQPMGVRVICGHCKNTFLWTEF TDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGTWKHARRYGGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS*
Price: £125.00
Completion Time: 
25
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
PreScission
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

TMEM55B

cDNA Synonyms: 
C14orf9; PIP4P1
DU Number: 
DU61981
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO Halo 3C TMEM55B K155E iso 2
Expressed: 
Halo 3C TMEM55B K155E iso 2
Genbank: 
NM_001100814.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MAEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEV VLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDRE PLWRFPNELPIAGEPANIVALVEEYMDWLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEISGLEV LFQGPGSMAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAGKHAPPQAFPPFPEGHPAVLPGEDPPPYSPLTSPDSGSAPMITCRV CQSLINVEGKMHQHVVKCGVCNEATPIKNAPPGKKYVRCPCNCLLICKVTSQRIACPRPYCERIINLGPVHPGPLSPEPQPMGVRVICGHCKNTFLWTEF TDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGTWKHARRYGGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
PreScission
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

Ubiquilin

cDNA Synonyms: 
-
DU Number: 
DU72875
Cost of Production: 
100.00
Plasmid: 
pET15D 6HiS-TEVb-HALO-Ubiquilin M557K L584K tetramer
Expressed: 
6HiS-TEVb-HALO-Ubiquilin M557K L584K tetramer
Genbank: 
NM_053067.2
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
117609
Project Type: 
D
Budget Group: 
C014
Funder Code: 
1673
Budget Centre: 
1046
Nominal Code: 
35907

SNX9

DU Number: 
DU72683
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO SNX9 D180-end 3C Halo
Expressed: 
SNX9 D180-End Halo 3C
Genbank: 
NM_016224.4 GI:525313625
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
12
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

SNX9

DU Number: 
DU72672
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO Halo 3C SNX9 D180-end
Expressed: 
Halo 3C SNX9 D180-end
Genbank: 
NM_016224.4 GI:525313625
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
11
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

SNX9

DU Number: 
DU72674
Cost of Production: 
80.00
Plasmid: 
pcDNA5D FRT/TO SNX9 M1-S200 3C Halo
Expressed: 
SNX9 1-S200 Halo 3C
Genbank: 
NM_016224.4 GI:525313625
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
12
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

SNX9

DU Number: 
DU72671
Cost of Production: 
80.00
Plasmid: 
pcDNA5D FRT/TO Halo 3C SNX9 M1-S200
Expressed: 
Halo 3C SNX9 M1-S200
Genbank: 
NM_016224.4 GI:525313625
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
11
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

SNX9

cDNA Synonyms: 
SDP1, SH3PX1, SH3PXD3A, WISP
DU Number: 
DU72673
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO SNX9 3C Halo
Expressed: 
SNX9 Halo 3C
Genbank: 
NM_016224.4 GI:525313625
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
17
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

SNX9

DU Number: 
DU72670
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO Halo 3C SNX9
Expressed: 
Halo 3C SNX9
Genbank: 
NM_016224.4 GI:525313625
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
11
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
PreScission
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

TMEM55B Isoform2

DU Number: 
DU72638
Cost of Production: 
80.00
Plasmid: 
pcDNA5D FRT/TO Halo 3C TMEM55B T90-L160
Expressed: 
Halo 3C TMEM55B T90-L160
Genbank: 
NM_144568.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
20
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
PreScission
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.