HA

RAPTOR

cDNA Synonyms: 
RPTOR; KOG1; Mip1
DU Number: 
DU76002
Plasmid: 
pCMV5 HA RAPTOR
Expressed: 
HA RAPTOR
Genbank: 
NM_020761.3 NP_065812
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAGSPEFALMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECW IDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMG SPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLV PGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVD ICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSAREL RPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQN FDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQFIE EEKNYALPSPATTEGGSLTPVRDSPCTPRLRSVSSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILSFETIDKM RRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYKATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSS LTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKE REWRFLRNSRVRRQAQQVIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTA TDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGD GSIRVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELI NNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR*
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
-

PPM1H

cDNA Synonyms: 
URCC2; ARHCL1; NERPP-2C
DU Number: 
DU61984
Cost of Production: 
110.00
Plasmid: 
pCMV5D HA PPM1H I67E
Expressed: 
HA PPM1H I67E
Genbank: 
Q9ULR3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAGSMLTRVKSAVANFMGGIMAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILELKETRRLPWATGYAEVINAGK STHNEDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENSESEGVSCHYWSLFDGHAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLP PTCLGEEPENTPANSRTLTRAASLRGGVGAPGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSSYNISGGCTALIVICLLGKLYVANAGD SRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKKMLYRDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGV TRGLGDHDLKVHDSNIYIKPFLSSAPEVRIYDLSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLVMRARGVLKDRGWR ISNDRLGSGDDISVYVIPLIHGNKLS*
Price: £125.00
Completion Time: 
18
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811523.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

PPM1J

cDNA Synonyms: 
PP2CZ; PPP2CZ; PP2Czeta; PP2C-zeta
DU Number: 
DU61987
Cost of Production: 
110.00
Plasmid: 
pCMV5D HA PPM1J S93I
Expressed: 
HA PPM1J S93I
Genbank: 
NM_005167.5
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAGSMLNRVRSAVAHLVSSGGAPPPRPKSPDLPNAASAPPAAAPEAPRSPPAKAGSGSATPAKAVEARASFSRPTFLQLSPGGLRRADDHAG RAVQIPPDTGRRLPWSTGYAEVINAGKSRHNEDQACCEVVYVEGRRSVTGVPREPSRGQGLCFYYWGLFDGHAGGGAAEMASRLLHRHIREQLKDLVEIL QDPSPPPLCLPTTPGTPDSSDPSHLLGPQSCWSSQKEVSHESLVVGAIENAFQLMDEQMARERRGHQVEGGCCALVVIYLLGKVYVANAGDSRAIIVRNG EIIPMSREFTPETERQRLQLLGFLKPELLGSEFTHLEFPRRVLPKELGQRMLYRDQNMTGWAYKKIELEDLRFPLVCGEGKKARVMATIGVTRGLGDHSL KVCSSTLPIKPFLSCFPEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSG DDISVFVIPLGGPGSYS*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811523.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

RAB29

cDNA Synonyms: 
RAB7L; RAB7L1
DU Number: 
DU61982
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT/TO HA RAB29 T71A S72A V156G
Expressed: 
HA RAB29 T71A S72A V156G
Genbank: 
NM_003929.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAGSMGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFAAMTRLYYRDASACVIMF DVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSGKENKNINEAMRVLIEKMMRNSTEDIMSLSTQG DYINLQTKSSSWSCC*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
118922.D.C001.2528.1046
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

PPM1J

cDNA Synonyms: 
PP2CZ; PPP2CZ; PP2Czeta; PP2C-zeta
DU Number: 
DU61983
Cost of Production: 
110.00
Plasmid: 
pCMV5D HA PPM1J S93A
Expressed: 
HA PPM1J S93A
Genbank: 
NM_005167.5
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAGSMLNRVRSAVAHLVSSGGAPPPRPKSPDLPNAASAPPAAAPEAPRSPPAKAGSGSATPAKAVEARASFSRPTFLQLSPGGLRRADDHAG RAVQAPPDTGRRLPWSTGYAEVINAGKSRHNEDQACCEVVYVEGRRSVTGVPREPSRGQGLCFYYWGLFDGHAGGGAAEMASRLLHRHIREQLKDLVEIL QDPSPPPLCLPTTPGTPDSSDPSHLLGPQSCWSSQKEVSHESLVVGAIENAFQLMDEQMARERRGHQVEGGCCALVVIYLLGKVYVANAGDSRAIIVRNG EIIPMSREFTPETERQRLQLLGFLKPELLGSEFTHLEFPRRVLPKELGQRMLYRDQNMTGWAYKKIELEDLRFPLVCGEGKKARVMATIGVTRGLGDHSL KVCSSTLPIKPFLSCFPEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSG DDISVFVIPLGGPGSYS*
Price: £125.00
Completion Time: 
19
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811523.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

NRBP2

cDNA Synonyms: 
TRG16; pp9320
DU Number: 
DU61977
Cost of Production: 
110.00
Plasmid: 
pCMV5D HA NRBP2 D462K E470K
Expressed: 
HA NRBP2 D462K E470K
Genbank: 
NM_178564.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAGSMAAPEPAPRRAREREREREDESEDESDILEESPCGRWQKRREQVNQGNMPGLQSTFLAMDTEEGVEVVWNELHFGDRKAFAAHEEKIQ TVFEQLVLVDHPNIVKLHKYWLDTSEACARVIFITEYVSSGSLKQFLKKTKKNHKAMNARAWKRWCTQILSALSFLHACSPPIIHGNLTSDTIFIQHNGL IKIGSVWHRIFSNALPDDLRSPIRAEREELRNLHFFPPEYGEVADGTAVDIFSFGMCALEMAVLEIQTNGDTRVTEEAIARARHSLSDPNMREFILCCLA RDPARRPSAHSLLFHRVLFEVHSLKLLAAHCFIQHQYLMPENVVEEKTKAMDLHAVLAELPRPRRPPLQWRYSEVSFMELDKFLEDVRNGIYPLMNFAAT RPLGLPRVLAPPPEEVQKAKTPTPEPFDSETRKVIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTKSAQDLASKLVHYGFLHEDDRMKLAAF LESTFLKYRGTQA*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
117609
Project Type: 
D
Budget Group: 
C004
Funder Code: 
1673
Budget Centre: 
1046
Nominal Code: 
35907

NRBP2

cDNA Synonyms: 
TRG16; pp9320
DU Number: 
DU61976
Cost of Production: 
110.00
Plasmid: 
pCMV5D HA NRBP2 D462A E470A
Expressed: 
HA NRBP2 D462A E470A
Genbank: 
NM_178564.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAGSMAAPEPAPRRAREREREREDESEDESDILEESPCGRWQKRREQVNQGNMPGLQSTFLAMDTEEGVEVVWNELHFGDRKAFAAHEEKIQ TVFEQLVLVDHPNIVKLHKYWLDTSEACARVIFITEYVSSGSLKQFLKKTKKNHKAMNARAWKRWCTQILSALSFLHACSPPIIHGNLTSDTIFIQHNGL IKIGSVWHRIFSNALPDDLRSPIRAEREELRNLHFFPPEYGEVADGTAVDIFSFGMCALEMAVLEIQTNGDTRVTEEAIARARHSLSDPNMREFILCCLA RDPARRPSAHSLLFHRVLFEVHSLKLLAAHCFIQHQYLMPENVVEEKTKAMDLHAVLAELPRPRRPPLQWRYSEVSFMELDKFLEDVRNGIYPLMNFAAT RPLGLPRVLAPPPEEVQKAKTPTPEPFDSETRKVIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTASAQDLASALVHYGFLHEDDRMKLAAF LESTFLKYRGTQA*
Price: £125.00
Completion Time: 
21
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
117609
Project Type: 
D
Budget Group: 
C004
Funder Code: 
1673
Budget Centre: 
1046
Nominal Code: 
35907

NRBP2

cDNA Synonyms: 
NRBP2
DU Number: 
DU72939
Cost of Production: 
100.00
Plasmid: 
pCMV5D HA NRBP2
Expressed: 
HA NRBP2
Genbank: 
NM_178564.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
10
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
117609
Project Type: 
D
Budget Group: 
C004
Funder Code: 
1673
Budget Centre: 
1046
Nominal Code: 
35907

LRRK2

cDNA Synonyms: 
PARK8; RIPK7; ROCO2; AURA17; DARDARIN
DU Number: 
DU72936
Cost of Production: 
80.00
Plasmid: 
pcDNA5D FRT TO HA LRRK2 D541-N710
Expressed: 
HA LRRK2 D541-N710
Genbank: 
NM_198578.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
16
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
Yes
Hidden Project: 
No
Cost Centre: 
118922.D.C001.2528.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

LRRK2

cDNA Synonyms: 
PARK8; RIPK7; ROCO2; AURA17; DARDARIN
DU Number: 
DU72934
Cost of Production: 
100.00
Plasmid: 
pcDNA5D FRT TO HA LRRK2 T2141-N2499
Expressed: 
HA LRRK2 T2141-N2499
Genbank: 
NM_198578.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
16
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
Yes
Hidden Project: 
No
Cost Centre: 
118922.D.C001.2528.1046
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.