HA

53BP1

cDNA Synonyms: 
TP53BP1
p202
DU Number: 
DU73956
Cost of Production: 
200.00
Plasmid: 
pcDNA5 FRT TO 53BP1 S308A HA (custom)
Expressed: 
GFP-53BP1 S308A-HA
Genbank: 
NM_001141980.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene map
Price: £110.00
Completion Time: 
12
Research Area: 
Diseases: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
Yes
Hidden Project: 
Yes
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Restricted Distribution
COVID-19: 
No
Ubiquitylation Site: 
No

PKB alpha

cDNA Synonyms: 
AKT1
DU Number: 
DU73285
Cost of Production: 
100.00
Plasmid: 
pcDNA5 FRT/TO HA PKB alpha E17K
Expressed: 
HA PKB alpha E17K
Genbank: 
NM_005163
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAMSDVAIVKEGWLHKRGKYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHV ETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKD EVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKI TDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQ RLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA*
Price: £110.00
Completion Time: 
22
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
Yes
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

Rnf12 (mouse)

cDNA Synonyms: 
AL022832; AW743871; Ha1r; Rlim
DU Number: 
DU61775
Cost of Production: 
100.00
Plasmid: 
pCAGGS puro HA mouse Rnf12 K558R K561R
Expressed: 
HA mouse Rnf12 K558R K561R
Genbank: 
NM_011276.3 GI:47078288
Species: 
Mouse
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGAGAACTCAGATTCTAACGATAAAGGAAGTGACCAGTCTGCAGCTCAGCGCAGAAGTCAAATGGATCGCTTGGATCGGGAAGAGGCTTTCTATCAATTTGTGAATAATCTCAGTGAAGAAGATTATAGACTTATGAGAGACAACAATTTGCTGGGCACCCCAGGTGAAAGTACTGAGGAAGAGTTGCTCAGAAGACTACAACAAATTAAAGAGGGTCCACCACCACAGAGCCCCGATGAAAATAGAGCTGGAGAGTCTTCAGATGATGTGACCAACAGTGATTCTATAATAGATTGGCTTAACTCAGTCAGACAGACTGGAAATACAACAAGAAGTGGTCAGAGAGGAAACCAGTCCTGGAGAGCAGTGAGCCGGACTAATCCAAACAGCGGTGATTTCAGATTCAGTTTAGAGATAAATGTTAACCGTAACAATGGAAGCCAAACTTCCGAGAATGAAAGTGAACCATCCACTAGGCGTCTTAGTGTAGAAAACATGGAGAGCAGCAGCCAAAGGCAAATGGAAAATTCTGCATCTGAATCAGCATCGGCCAGACCTTCTCGAGCGGAGCGCAATTCAGCTGAAGCAGTAACAGAAGTGCCGACCACCAGAGCTCAGAGGAGGGCAAGAAGCCGGAGCCCAGAGCATCGGAGAACCAGAGCAAGAGCTGAAAGAAGCAGGTCCCCTCTGCAGCCAACAAGTGAAATTCCACGAAGAGCTCCGACCTTGGAGCAGTCTTCGGAAAACGAGCCTGAAGGAAGTTCTAGAACCCGGCACCATGTGACCCTGAGACAGCAGATATCTGGACCGGAGTTGTTAGGTAGAGGTCTTTTTGCAGCTTCTGGATCAAGAAACCCCTCTCAGGGGACAAGCTCTTCAGACACAGGTAGCAATAGTGAATCCTCAGGATCTGGCCAAAGACCTCCAACCATAGTTCTTGATCTTCAAGTAAGAAGAGTTCGTCCTGGAGAATACCGGCAGAGAGATAGTATAGCTAGCAGAACTCGATCAAGATCTCAGGCTCCGAACAACACAGTTACTTATGAAAGTGAACGTGGAGGTTTTAGGCGTACCTTTTCCCGTTCTGAACGTGCAGGTGTGAGAACCTATGTGAGTACTATCAGGATTCCTATTCGCAGAATCTTAAATACTGGATTAAGTGAAACTACATCTGTTGCAATTCAAACCATGTTAAGGCAGATAATGACAGGCTTTGGTGAGCTAAGCTACTTTATGTACAGTGACAGTGATTCAGAGCCTAGTGCCTCAGTCTCCAGCCGAAATGTGGAGAGAGTAGAGTCACGGAATGGAAGAGGGAGCTCTGGTGGCGGTAACAGCTCTGGTTCCAGTTCCAGCTCAAGTCCTAGCCCCAGTTCAAGTGGTGAAAGTTCCGAGAGTAGCTCAGAGATGTTCGAAGGCAGTAGTGAAGGAGGCTCGTCTGGCCCATCCAGAAGAGATGGTCGACATAGGGCCCCAGTCACATTTGATGAAAGTGGCTCTCTGCCATTCCTTAGTCTGGCTCAGTTTTTTCTTTTAAATGAAGATGATGAAGACCAACCTAGAGGACTCACTAAAGAACAGATCGATAACTTGGCAATGAGAAGCTTTGGTGAAAATGATGCATTGAAAACGTGTAGTGTTTGCATTACAGAATACACAGAAGGCAACAGACTTCGTAGACTACCTTGCTCCCATGAGTACCACGTCCACTGCATCGACCGCTGGTTGTCTGAGAATTCCACCTGTCCCATTTGTCGCAGGGCAGTCTTATCTTCTGGGAACAGAGAAAGTGTTGTGTGAGCGGCCGC
Amino Acid Sequence: 
MYPYDVPDYAGSMENSDSNDKGSDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQSPDENRAGESSDDVTNSDSIIDWLNSVRQTGNTTRSGQRGNQSWRAVSRTNPNSGDFRFSLEINVNRNNGSQTSENESEPSTRRLSVENMESSSQRQMENSASESASARPSRAERNSAEAVTEVPTTRAQRRARSRSPEHRRTRARAERSRSPLQPTSEIPRRAPTLEQSSENEPEGSSRTRHHVTLRQQISGPELLGRGLFAASGSRNPSQGTSSSDTGSNSESSGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQAPNNTVTYESERGGFRRTFSRSERAGVRTYVSTIRIPIRRILNTGLSETTSVAIQTMLRQIMTGFGELSYFMYSDSDSEPSASVSSRNVERVESRNGRGSSGGGNSSGSSSSSSPSPSSSGESSESSSEMFEGSSEGGSSGPSRRDGRHRAPVTFDESGSLPFLSLAQFFLLNEDDEDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGNRLRRLPCSHEYHVHCIDRWLSENSTCPICRRAVLSSGNRESVV*
Price: £110.00
Completion Time: 
13
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
Yes
Reagent Type: 

Cas9

DU Number: 
DU70263
Plasmid: 
pKN101 [expression vector for gRNA, Cas9-D10A ‘nickase’ and Puromycin-resistance gene]
Expressed: 
HA NLS Cas9 D10A NLS
Genbank: 
-
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
See snapgene file
Amino Acid Sequence: 
MYPYDVPDYASPKKKRKVEASDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRIC YLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSD VDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLA QIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPIL EKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEE VVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEI SGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTIL DFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRER MKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMK NYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINN YHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDF ATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPID FLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRV ILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSPKKKRKVEAS*
Price: £110.00
Completion Time: 
0
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No

NUAK1

cDNA Synonyms: 
ARK5
DU Number: 
DU70086
Cost of Production: 
100.00
Plasmid: 
pcDNA5-FRT/TO-HA NUAK1 M132Q (custom) (CPHKS44)
Expressed: 
HA NUAK1 M132Q
Genbank: 
NM_014840
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQETLGKGTYGKVKRATERFSGRVVAIKSIRKDKI KDEQDMVHIRREIEIMSSLNHPHIISIYEVFENKDKIVIIQEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLKLENILLDDNCN IKIADFGLSNLYQKDKFLQTFCGSPLYASPEIVNGRPYRGPEVDSWALGVLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDARGLIRWMLMVNP DRRATIEDIANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMKGLAKPTTSEVMLERQRSLKKSKKENDFAQSGQDAVPESPSK LSSKRPKGILKKRSNSEHRSHSTGFIEGVVGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYSSPERSESSELL DSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQEN RPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKLN*
Price: £110.00
Completion Time: 
10
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
Yes
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Restricted Distribution
COVID-19: 
No

NUAK1

cDNA Synonyms: 
ARK5
DU Number: 
DU70085
Cost of Production: 
100.00
Plasmid: 
pcDNA5-FRT/TO-HA NUAK1 M132L (custom) (CPHKS43)
Expressed: 
HA NUAK1 M132L
Genbank: 
NM_014840
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQETLGKGTYGKVKRATERFSGRVVAIKSIRKDKI KDEQDMVHIRREIEIMSSLNHPHIISIYEVFENKDKIVIILEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLKLENILLDDNCN IKIADFGLSNLYQKDKFLQTFCGSPLYASPEIVNGRPYRGPEVDSWALGVLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDARGLIRWMLMVNP DRRATIEDIANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMKGLAKPTTSEVMLERQRSLKKSKKENDFAQSGQDAVPESPSK LSSKRPKGILKKRSNSEHRSHSTGFIEGVVGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYSSPERSESSELL DSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQEN RPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKLN*
Price: £110.00
Completion Time: 
10
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
Yes
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Restricted Distribution
COVID-19: 
No

NUAK1

cDNA Synonyms: 
ARK5
DU Number: 
DU70084
Cost of Production: 
100.00
Plasmid: 
pcDNA5-FRT/TO-HA NUAK1 M132T (custom) (CPHKS42)
Expressed: 
HA NUAK1 M132T
Genbank: 
NM_014840
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQETLGKGTYGKVKRATERFSGRVVAIKSIRKDKI KDEQDMVHIRREIEIMSSLNHPHIISIYEVFENKDKIVIITEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLKLENILLDDNCN IKIADFGLSNLYQKDKFLQTFCGSPLYASPEIVNGRPYRGPEVDSWALGVLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDARGLIRWMLMVNP DRRATIEDIANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMKGLAKPTTSEVMLERQRSLKKSKKENDFAQSGQDAVPESPSK LSSKRPKGILKKRSNSEHRSHSTGFIEGVVGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYSSPERSESSELL DSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQEN RPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKLN*
Price: £110.00
Completion Time: 
10
Target Family: 
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
Yes
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Restricted Distribution
COVID-19: 
No

TMEM115

cDNA Synonyms: 
PL6
DU Number: 
DU70026
Cost of Production: 
80.00
Plasmid: 
pLJC5 short kozak TMEM115 1-229 3HA
Expressed: 
TMEM115 1-229 3HA
Genbank: 
NM_007024.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
See attached snapgene file
Amino Acid Sequence: 
See attached snapgene file
Price: £110.00
Completion Time: 
9
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801568.R104
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No

TMEM115

cDNA Synonyms: 
PL6
DU Number: 
DU70035
Cost of Production: 
100.00
Plasmid: 
pLJC5 short kozak 3HA TMEM115
Expressed: 
3HA TMEM115
Genbank: 
NM_007024.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
See attached snapgene file
Amino Acid Sequence: 
See attached snapgene file
Price: £110.00
Completion Time: 
9
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801568.R104
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No

OMP25

cDNA Synonyms: 
Synj2bp
DU Number: 
DU70025
Cost of Production: 
80.00
Plasmid: 
pLJC5 short kozak 3HA GFP OMP25 Rat aa109-145
Expressed: 
3HA GFP OMP25 Rat aa109-145
Genbank: 
NM_022599.2
Species: 
Rat
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MYPYDVPDYAYPYDVPDYAYPYDVPDYAMHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMHRGDGEPSGVPVAVVLLPVFALTLVAVWAFVRYRKQL*
Price: £110.00
Completion Time: 
9
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.