FLAG

TLK1

DU Number: 
DU73362
Cost of Production: 
100.00
Plasmid: 
pcDNA5-FRT/TO-FLAG TLK1 D607A
Expressed: 
FLAG-TLK1 D607A
Genbank: 
NM_012290.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MDYKDDDDKGSMSVQSSSGSLEGPPSWSQLSTSPTPGSAAAARSLLNHTPPSGRPREGAMDELHSLDPRRQELLEARFTGVASGSTGSTGSCSVGAKAST NNESSNHSFGSLGSLSDKESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSP SPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQDLEKKEGRIDDLLRANCDLRRQIDEQQKLLEKYKERLNKCISMSKKLLIEKSTQEKLSS REKSMQDRLRLGHFTTVRHGASFTEQWTDGFAFQNLVKQQEWVNQQREDIERQRKLLAKRKPPTANNSQAPSTNSEPKQRKNKAVNGAENDPFVRPNLPQ LLTLAEYHEQEEIFKLRLGHLKKEEAEIQAELERLERVRNLHIRELKRINNEDNSQFKDHPTLNERYLLLHLLGRGGFSEVYKAFDLYEQRYAAVKIHQL NKSWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLDTDTFCTVLEYCEGNDLDFYLKQHKLMSEKEARSIVMQIVNALRYLNEIKPPIIHYDLKP GNILLVDGTACGEIKITAFGLSKIMDDDSYGVDGMDLTSQGAGTYWYLPPECFVVGKEPPKISNKVDVWSVGVIFFQCLYGRKPFGHNQSQQDILQENTI LKATEVQFPVKPVVSSEAKAFIRRCLAYRKEDRFDVHQLANDPYLLPHMRRSNSSGNLHMAGLTASPTPPSSSIITY*
Price: £110.00
Completion Time: 
33
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
No

SLX4

DU Number: 
DU70657
Cost of Production: 
120.00
Plasmid: 
pcDNA5D FRT/TO FLAG SLX4 T1524A T1544A T1561A T1571A T1676A S1681A
Expressed: 
FLAG SLX4 T1524A T1544A T1561A T1571A T1676A S1681A
Genbank: 
NM_032444.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
ggatccATGAAACTGAGTGTGAATGAGGCTCAGCTAGGCTTCTACTTGGGTTCACTTTCTCATCTGTCTGCCTGTCCTGGGATTGACCCTCGCTCCTCTGAAGACCAGCCTGAAAGCCTTAAAACTGGTCAGATGATGGATGAGTCTGATGAGGACTTTAAAGAACTCTGCGCTAGCTTTTTCCAAAGGGTGAAAAAACATGGAATCAAGGAAGTGTCAGGAGAAAGGAAGACACAAAAGGCTGCCTCAAACGGCACTCAGATAAGAAGCAAATTGAAAAGGACCAAACAAACTGCTACCAAGACCAAAACCCTTCAAGGCCCTGCAGAGAAGAAACCTCCGTCTGGCAGCCAGGCCCCTAGGACTAAAAAGCAAAGGGTAACCAAATGGCAAGCAAGTGAACCGGCCCACTCTGTGAATGGGGAGGGGGGTGTGCTTGCCTCTGCTCCAGATCCACCTGTGCTCCGGGAAACAGCACAAAACACCCAGACGGGTAACCAGCAAGAACCATCGCCAAACCTTTCCAGAGAGAAAACCAGAGAGAATGTGCCCAACAGCGACTCCCAGCCTCCTCCTTCCTGTTTGACAACAGCAGTGCCAAGTCCCTCCAAACCCCGCACAGCACAATTGGTCCTACAGCGAATGCAGCAGTTCAAGAGAGCAGACCCCGAGCGTTTGAGACACGCTTCAGAAGAGTGCTCCCTCGAGGCTGCGCGGGAAGAAAATGTCCCAAAGGACCCTCAAGAGGAGATGATGGCGGGGAATGTGTATGGGCTTGGGCCCCCTGCCCCAGAGAGCGACGCTGCGGTGGCCTTGACCCTGCAGCAGGAGTTTGCACGGGTAGGAGCATCGGCACATGATGATAGCCTGGAGGAAAAGGGTTTGTTCTTCTGCCAGATTTGTCAAAAGAACCTCTCAGCCATGAACGTGACCCGAAGGGAACAGCATGTGAACAGGTGCTTGGATGAAGCTGAAAAGACACTAAGACCTTCTGTGCCTCAGATCCCTGAGTGCCCGATTTGTGGGAAACCGTTTCTTACCTTAAAGAGCAGAACCAGTCACTTGAAGCAGTGTGCTGTGAAGATGGAGGTTGGCCCCCAGCTCCTGCTTCAGGCTGTGCGGCTGCAGACAGCACAGCCTGAGGGTAGCAGCAGCCCACCCATGTTCAGCTTCAGTGATCACAGTAGAGGTCTGAAACGGAGAGGACCCACCAGCAAGAAGGAGCCACGGAAGAGGCGGAAGGTGGACGAGGCACCGTCCGAGGACCTGCTGGTGGCCATGGCTCTGTCCCGGTCGGAGATGGAGCCGGGTGCGGCTGTACCAGCGCTCAGGCTGGAAAGTGCCTTTTCTGAGAGGATAAGACCAGAAGCAGAGAATAAAAGTCGCAAGAAGAAACCCCCGGTATCCCCCCCATTGTTGTTAGTCCAGGACTCTGAAACCACAGGCCGACAGATAGAGGACCGTGTGGCCCTGCTCCTCTCTGAGGAAGTGGAATTGTCTAGCACGCCACCACTTCCTGCCAGCAGGATTTTAAAGGAAGGGTGGGAAAGAGCGGGCCAGTGTCCTCCTCCACCTGAACGCAAGCAGAGCTTTCTGTGGGAGGGCAGCGCACTGACTGGGGCCTGGGCCATGGAGGACTTCTACACGGCCAGGCTGGTCCCTCCTCTCGTGCCCCAGCGGCCTGCCCAGGGCCTTATGCAGGAGCCCGTGCCGCCTCTGGTGCCACCTGAGCACTCAGAGCTGAGCGAGCGAAGGTCACCCGCTCTCCACGGCACCCCCACTGCAGGCTGTGGCTCCAGGGGCCCGTCGCCTTCGGCCAGCCAGAGGGAGCACCAGGCCCTGCAGGACCTCGTGGACCTGGCGAGGGAGGGACTGAGCGCCAGCCCGTGGCCCGGCAGTGGGGGCCTGGCTGGCTCGGAAGGGACTGCAGGGTTGGACGTGGTGCCCGGCGGCCTTCCTCTGACTGGGTTTGTGGTGCCATCGCAGGACAAGCACCCGGACAGGGGCGGCCGAACCTTGCTCTCCCTCGGGCTGCTGGTTGCTGACTTTGGCGCCATGGTCAATAACCCACACCTGAGTGATGTCCAGTTTCAGACGGACAGCGGGGAGGTGCTTTACGCCCACAAGTTCGTGCTTTATGCCCGATGCCCGCTCCTCATCCAGTATGTGAACAATGAAGGCTTCTCCGCTGTAGAGGACGGGGTTCTGACCCAGCGTGTCCTGCTGGGTGACGTGAGCACCGAGGCCGCCCGCACGTTCCTGCACTATCTCTACACTGCGGACACTGGCCTTCCTCCTGGCCTTAGCTCTGAGCTGAGCTCCCTGGCCCACAGGTTTGGCGTGAGTGAGCTCGTTCACCTGTGCGAACAGGTGCCTATTGCCACTGACTCAGAGGGCAAACCATGGGAGGAGAAGGAAGCAGAGAATTGCGAAAGCAGGGCCGAGAATTTCCAGGAACTtTTGAGGTCAATGTGGGCAGATGAAGAGGAGGAAGCGGAGACTTTGTTGAAATCCAAGGACCACGAAGAAGATCAAGAAAACGTGAATGAAGCAGAAATGGAAGAAATTTATGAATTTGCAGCTACTCAGCGAAAGCTTCTCCAGGAAGAAAGGGCAGCGGGTGCCGGCGAGGACGCTGACTGGCTGGAGGGTGGCAGTCCGGTTTCTGGGCAACTCCTAGCAGGTGTCCAGGTGCAGAAACAGTGGGACAAGGTGGAGGAGATGGAGCCGTTGGAGCCAGGAAGAGATGAGGCCGCCACCACCTGGGAGAAGATGGGACAGTGCGCTCTCCCGCCACCCCAGGGCCAGCACTCAGGGGCACGGGGAGCAGAGGCCCCTGAGCAGGAGGCGCCAGAGGAGGCGCTTGGCCATTCCAGCTGCTCCAGCCCTTCCAGGGACTGCCAGGCAGAGAGAAAAGAAGGCTCTCTTCCGCACTCAGATGATGCCGGGGATTACGAACAGCTCTTCTCATCAACTCAGGGAGAGATCTCAGAGCCGTCCCAAATAACAAGTGAGCCCGAGGAACAAAGTGGCGCTGTCAGGGAAAGGGGGCTGGAGGTTTCTCATCGCCTGGCTCCCTGGCAGGCATCTCCACCGCACCCGTGCCGCTTCCTATTGGGGCCTCCCCAGGGCGGGAGTCCCCGCGGGTCTCATCACACAAGTGGGTCGTCCCTGTCAACACCCCGGTCCCGTGGCGGAACTTCCCAGGTGGGCTCCCCAACCTTGCTGTCTCCAGCTGTGCCATCAAAGCAGAAAAGGGACAGGAGCATCCTCACGCTGTCTAAAGAGCCAGGGCACCAGAAAGGCAAAGAGCGTCGGTCCGTGCTGGAGTGCAGAAATAAGGGGGTCCTGATGTTCCCAGAAAAATCTCTGTCTATTGACCTAACCCAGTCAAATCCTGACCATTCGAGCTCCAGATCTCAGAAATCTTCATCCAAACTGAACGAAGAAGATGAGGTCATCCTCTTACTGGACTCGGATGAGGAGCTGGAGCTAGAACAAACCAAAATGAAGTCCATTTCTAGTGATCCTCTGGAAGAAAAGAAAGCTCTAGAAATTAGCCCTAGGTCCTGTGAGCTGTTTTCCATCATTGATGTTGATGCAGATCAGGAACCTTCCCAGAGCCCACCAAGAAGCGAAGCTGTGCTGCAGCAGGAGGATGAGGGGGCGCTGCCGGAGAATCGGGGCTCTTTGGGCAGGAGAGGGGCTCCCTGGCTGTTCTGTGACCGTGAGAGCAGCCCCAGCGAGGCCAGCACCACAGACACCTCGTGGCTGGTGCCCGCCACCCCGCTGGCCAGCAGAAGCCGTGACTGTTCTTCCCAGACCCAAATCAGCAGCCTCAGGAGCGGGCTGGCCGTGCAGGCGGTGACTCAGCACACGCCCAGGGCCTCAGTAGGAAACAGGGAAGGGAACGAAGTCGCACAGAAGTTTTCTGTCATCAGGCCCCAGACACCACCGCCCCAGACACCGTCCTCATGCCTCACTCCCGTCTCTCCAGGAACTTCTGACGGCAGAAGGCAAGGCCACAGAAGCCCTTCCCGTCCCCACCCCGGGGGCCACCCGCACTCCTCTCCGCTGGCTCCACATCCCATCTCAGGGGACCGCGCCCACTTCAGCAGGCGGTTCCTGAAACACTCGCCGCCTGGGCCAAGCTTCCTGAACCAGACCCCAGCGGGTGAAGTGGTGGAAGTCGGAGACAGTGACGATGAGCAGGAGGTGGCCTCCCATCAGGCCAACAGAAGCCCCCCACTGGACAGTGACCCCCCAATTCCAATTGACGACTGCTGCTGGCACATGGAGCCCCTCTCGCCAATTCCCATTGACCACTGGAACCTGGAGCGGACCGGCCCCCTGAGCACCAGCAGCCCCAGCCGCAGGATGAACGAGGCCGCCGACAGCCGTGACTGTCGCTCCCCGGGACTCCTGGACACCACCCCCATCCGAGGAAGCTGCACTACCCAGAGGAAATTGCAAGAGAAGTCCTCGGGCGCGGGCTCCCTGGGGAACAGCAGGCCGAGCTTTCTGAATTCGGCTCTGTGGGACGTTTGGGACGGGGAAGAGCAGAGGCCTCCAGAGgCCCCTCCTCCGGCCCAGATGCCAAGCGCTGGTGGAGCTCAGAAGCCCGAAGGGTTAGAGgCACCCAAAGGTGCTAATCGGAAGAAGAACTTGCCCCCCAAAGTGCCCATAgCGCCGATGCCACAGTATTCCATTATGGAGgCGCCGGTGCTGAAGAAGGAACTGGATAGGTTTGGAGTCCGCCCTCTGCCTAAACGCCAGATGGTTCTGAAGCTGAAGGAGATATTCCAGTACACTCACCAGACCCTGGACTCAGACTCCGAGGACGAGAGCCAGTCCTCACAGCCGCTGTTGCAGGCGCCTCACTGCCAGACCCTCGCCTCCCAGACCTACAAGCCTTCAAGGGCAGGGGTCCATGCCCAGCAGGAGGCCACCACAGGACCTGGGGCCCATAGGCCCAAGGGACCTGCTAAGACCAAGGGCCCCCGACATCAAAGGAAGCATCATGAAAGCATCgCACCCCCAAGCAGGgCGCCCACCAAGGAGGCACCTCCAGGCCTCAATGATGACGCCCAGATCCCAGCCTCTCAAGAATCCGTGGCCACCTCTGTGGATGGCAGTGACAGCTCCTTGAGCTCACAGAGTTCTTCCTCCTGTGAGTTTGGAGCGGCATTTGAGTCTGCAGGTGAAGAGGAGGGCGAGGGGGAGGTCAGTGCCTCGCAGGCAGCCGTGCAGGCGGCGGACACAGACGAGGCGCTGAGGTGCTACATCCGCTCCAAGCCGGCCCTGTACCAGAAGGTGCTGCTGTACCAGCCCTTTGAGCTGCGGGAGCTGCAGGCAGAGCTGAGGCAGAACGGCCTCCGTGTGTCCTCGCGCAGGCTGTTGGACTTCCTGGACACCCACTGTATCACCTTCACCACTGCCGCCACCCGCAGGGAGAAGCTCCAGGGCAGGAGGCGGCAGCCTCGGGGCAAGAAGAAGGTGGAGCGGAACTGAgcggccgc
Amino Acid Sequence: 
MDYKDDDDKGSMKLSVNEAQLGFYLGSLSHLSACPGIDPRSSEDQPESLKTGQMMDESDEDFKELCASFFQRVKKHGIKEVSGERKTQKAASNGTQIRSK LKRTKQTATKTKTLQGPAEKKPPSGSQAPRTKKQRVTKWQASEPAHSVNGEGGVLASAPDPPVLRETAQNTQTGNQQEPSPNLSREKTRENVPNSDSQPP PSCLTTAVPSPSKPRTAQLVLQRMQQFKRADPERLRHASEECSLEAAREENVPKDPQEEMMAGNVYGLGPPAPESDAAVALTLQQEFARVGASAHDDSLE EKGLFFCQICQKNLSAMNVTRREQHVNRCLDEAEKTLRPSVPQIPECPICGKPFLTLKSRTSHLKQCAVKMEVGPQLLLQAVRLQTAQPEGSSSPPMFSF SDHSRGLKRRGPTSKKEPRKRRKVDEAPSEDLLVAMALSRSEMEPGAAVPALRLESAFSERIRPEAENKSRKKKPPVSPPLLLVQDSETTGRQIEDRVAL LLSEEVELSSTPPLPASRILKEGWERAGQCPPPPERKQSFLWEGSALTGAWAMEDFYTARLVPPLVPQRPAQGLMQEPVPPLVPPEHSELSERRSPALHG TPTAGCGSRGPSPSASQREHQALQDLVDLAREGLSASPWPGSGGLAGSEGTAGLDVVPGGLPLTGFVVPSQDKHPDRGGRTLLSLGLLVADFGAMVNNPH LSDVQFQTDSGEVLYAHKFVLYARCPLLIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQV PIATDSEGKPWEEKEAENCESRAENFQELLRSMWADEEEEAETLLKSKDHEEDQENVNEAEMEEIYEFAATQRKLLQEERAAGAGEDADWLEGGSPVSGQ LLAGVQVQKQWDKVEEMEPLEPGRDEAATTWEKMGQCALPPPQGQHSGARGAEAPEQEAPEEALGHSSCSSPSRDCQAERKEGSLPHSDDAGDYEQLFSS TQGEISEPSQITSEPEEQSGAVRERGLEVSHRLAPWQASPPHPCRFLLGPPQGGSPRGSHHTSGSSLSTPRSRGGTSQVGSPTLLSPAVPSKQKRDRSIL TLSKEPGHQKGKERRSVLECRNKGVLMFPEKSLSIDLTQSNPDHSSSRSQKSSSKLNEEDEVILLLDSDEELELEQTKMKSISSDPLEEKKALEISPRSC ELFSIIDVDADQEPSQSPPRSEAVLQQEDEGALPENRGSLGRRGAPWLFCDRESSPSEASTTDTSWLVPATPLASRSRDCSSQTQISSLRSGLAVQAVTQ HTPRASVGNREGNEVAQKFSVIRPQTPPPQTPSSCLTPVSPGTSDGRRQGHRSPSRPHPGGHPHSSPLAPHPISGDRAHFSRRFLKHSPPGPSFLNQTPA GEVVEVGDSDDEQEVASHQANRSPPLDSDPPIPIDDCCWHMEPLSPIPIDHWNLERTGPLSTSSPSRRMNEAADSRDCRSPGLLDTTPIRGSCTTQRKLQ EKSSGAGSLGNSRPSFLNSALWDVWDGEEQRPPEAPPPAQMPSAGGAQKPEGLEAPKGANRKKNLPPKVPIAPMPQYSIMEAPVLKKELDRFGVRPLPKR QMVLKLKEIFQYTHQTLDSDSEDESQSSQPLLQAPHCQTLASQTYKPSRAGVHAQQEATTGPGAHRPKGPAKTKGPRHQRKHHESIAPPSRAPTKEAPPG LNDDAQIPASQESVATSVDGSDSSLSSQSSSSCEFGAAFESAGEEEGEGEVSASQAAVQAADTDEALRCYIRSKPALYQKVLLYQPFELRELQAELRQNG LRVSSRRLLDFLDTHCITFTTAATRREKLQGRRRQPRGKKKVERN*
Price: £110.00
Completion Time: 
6
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
Yes
Hidden Project: 
No
Cost Centre: 
357.801626.R107
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No

Human UBA1

cDNA Synonyms: 
UBE1
DU Number: 
DU70578
Plasmid: 
pLIB 5Flag-Tev-HsUBA1 (pTL1)
Expressed: 
5Flag-Tev-HsUBA1
Genbank: 
NM_003334.4
Vector Type: 
Baculovirus
Tag: 
Amino Acid Sequence: 
MADYKDDDDKDYKDDDDKLMDYKDDDDKDYKDDDDKLMDYKDDDDKHMYGAGAGAGAGASENLYFQGGASSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPRNEEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEVLTEDKCLQRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEIIVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR*
Price: £110.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Cost Centre: 
117609.D.C005.1673.1046
Extra Protein: 
No
Cleavage Site: 
TEV
Restricted Distribution: 
Not Restricted
COVID-19: 
No

ULK1

DU Number: 
DU55078
Plasmid: 
pBabeD hygro FLAG ULK1 S556A T575A siRNA resistant
Expressed: 
Flag-ULK1 S556A T575A siRNA resistant
Genbank: 
NM_003565.2 GI:225637564 c2141t (P714L (exisiting SNP)
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
see attachment
Amino Acid Sequence: 
*
Price: £110.00
Completion Time: 
34
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No

TMEM115

cDNA Synonyms: 
PL6
DU Number: 
DU70023
Cost of Production: 
100.00
Plasmid: 
pLJC5 short kozak 2FLAG TMEM115
Expressed: 
2FLAG TMEM115
Genbank: 
NM_007024.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
See attached snapgene file
Amino Acid Sequence: 
See attached snapgene file
Price: £110.00
Completion Time: 
9
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801568.R104
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No

TSC22D2

cDNA Synonyms: 
TILZ4a; TILZ4b; TILZ4c; TSC22
DU Number: 
DU67989
Cost of Production: 
100.00
Plasmid: 
pCMV5 FLAG1 TSC22D2 M1- G646 R158A
Expressed: 
FLAG-TSC22D2 1-646 R158A
Genbank: 
NM_001303264.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MDYKDDDDKGSMPAKKKSCFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPEEVCERSSSEETLNNVGDAETPGTVSPNLLLDG QLAAAAAAPANGGGVVSARSVSGALASTLAAAATSAPAPGAPGGPQLAGSSAGPVTAAPSQPPTTCSSAFRVIKLDHGSGEPYRRGRWTCMEYYERDSDS SVLTRSGDCIRHSSTFDQTAERDSGLGATGGSVVVVVASMQGAHGPESGTDSSLTAVSQLPPSEKMSQPTPAQPQSFSVGQPQPPPPPVGGAVAQSSAPL PPFPGAATGPQPMMAAAQPSQPQGAGPGGQTLPPTNVTLAQPAMSLPPQPGPAVGAPAAQQPQQFAYPQPQIPPGHLLPVQPSGQSEYLQQHVAGLQPPS PAQPSSTGAAASPATAATLPVGTGQNASSVGAQLMGASSQPSEAMAPRTGPAQGGQVAPCQPTGVPPATVGGVVQPCLGPAGAGQPQSVPPPQMGGSGPL SAVPGGPHAVVPGVPNVPAAVPAPSVPSVSTTSVTMPNVPAPLAQSQQLSSHTPVSRSSSIIQHVGLPLAPGTHSAPTSLPQSDLSQFQTQTQPLVGQVD DTRRKSEPLPQPPLSLIAENKPVVKPPVADSLANPLQLTPMNSLATSVFSIAIPVDG*
Price: £110.00
Completion Time: 
12
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R104
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No

TSC22D2

cDNA Synonyms: 
TILZ4a; TILZ4b; TILZ4c; TSC22
DU Number: 
DU67988
Cost of Production: 
100.00
Plasmid: 
pCMV5 FLAG1 TSC22D2 M1- G646
Expressed: 
FLAG-TSC22D2 1-646
Genbank: 
NM_001303264.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MDYKDDDDKGSMPAKKKSCFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPEEVCERSSSEETLNNVGDAETPGTVSPNLLLDG QLAAAAAAPANGGGVVSARSVSGALASTLAAAATSAPAPGAPGGPQLAGSSAGPVTAAPSQPPTTCSSRFRVIKLDHGSGEPYRRGRWTCMEYYERDSDS SVLTRSGDCIRHSSTFDQTAERDSGLGATGGSVVVVVASMQGAHGPESGTDSSLTAVSQLPPSEKMSQPTPAQPQSFSVGQPQPPPPPVGGAVAQSSAPL PPFPGAATGPQPMMAAAQPSQPQGAGPGGQTLPPTNVTLAQPAMSLPPQPGPAVGAPAAQQPQQFAYPQPQIPPGHLLPVQPSGQSEYLQQHVAGLQPPS PAQPSSTGAAASPATAATLPVGTGQNASSVGAQLMGASSQPSEAMAPRTGPAQGGQVAPCQPTGVPPATVGGVVQPCLGPAGAGQPQSVPPPQMGGSGPL SAVPGGPHAVVPGVPNVPAAVPAPSVPSVSTTSVTMPNVPAPLAQSQQLSSHTPVSRSSSIIQHVGLPLAPGTHSAPTSLPQSDLSQFQTQTQPLVGQVD DTRRKSEPLPQPPLSLIAENKPVVKPPVADSLANPLQLTPMNSLATSVFSIAIPVDG*
Price: £110.00
Completion Time: 
12
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.801626.R104
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No

IRF5

cDNA Synonyms: 
SLEB10
IRF-5
DU Number: 
DU67886
Cost of Production: 
200.00
Plasmid: 
pCMV5 FLAG IRF5 S431C (custom)
Expressed: 
FLAG IRF5 S431C
Genbank: 
NP_116032.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
See snapgene file
Amino Acid Sequence: 
See snapgene file
Price: £110.00
Completion Time: 
14
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
Yes
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Restricted Distribution
COVID-19: 
No

IRF5

cDNA Synonyms: 
SLEB10
IRF-5
DU Number: 
DU67885
Cost of Production: 
200.00
Plasmid: 
pCMV5 FLAG IRF5 S431A (custom)
Expressed: 
FLAG IRF5 S431A
Genbank: 
NP_116032.1
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
See snapgene file
Amino Acid Sequence: 
See snapgene file
Price: £110.00
Completion Time: 
14
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
Yes
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Restricted Distribution
COVID-19: 
No

LRRK2

cDNA Synonyms: 
AURA17; DARDARIN; PARK8; RIPK7; ROCO2
DU Number: 
DU61332
Cost of Production: 
150.00
Plasmid: 
pCMV5 FLAG LRRK2 F699L
Expressed: 
FLAG LRRK2 F699L
Genbank: 
NM_198578.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCATGGCTAGTGGCAGCTGTCAGGGGTGCGAAGAGGACGAGGAAACTCTGAAGAAGTTGATAGTCAGGCTGAACAATGTCCAGGAAGGAAAACAGATAGAAACGCTGGTCCAAATCCTGGAGGATCTGCTGGTGTTCACGTACTCCGAGCACGCCTCCAAGTTATTTCAAGGCAAAAATATCCATGTGCCTCTGTTGATCGTCTTGGACTCCTATATGAGAGTCGCGAGTGTGCAGCAGGTGGGTTGGTCACTTCTGTGCAAATTAATAGAAGTCTGTCCAGGTACAATGCAAAGCTTAATGGGACCCCAGGATGTTGGAAATGATTGGGAAGTCCTTGGTGTTCACCAATTGATTCTTAAAATGCTAACAGTTCATAATGCCAGTGTAAACTTGTCAGTGATTGGACTGAAGACCTTAGATCTCCTCCTAACTTCAGGTAAAATCACCTTGCTGATATTGGATGAAGAAAGTGATATTTTCATGTTAATTTTTGATGCCATGCACTCATTTCCAGCCAATGATGAAGTCCAGAAACTTGGATGCAAAGCTTTACATGTGCTGTTTGAGAGAGTCTCAGAGGAGCAACTGACTGAATTTGTTGAGAACAAAGATTATATGATATTGTTAAGTGCGTTAACAAATTTTAAAGATGAAGAGGAAATTGTGCTTCATGTGCTGCATTGTTTACATTCCCTAGCGATTCCTTGCAATAATGTGGAAGTCCTCATGAGTGGCAATGTCAGGTGTTATAATATTGTGGTGGAAGCTATGAAAGCATTCCCTATGAGTGAAAGAATTCAAGAAGTGAGTTGCTGTTTGCTCCATAGGCTTACATTAGGTAATTTTTTCAATATCCTGGTATTAAACGAAGTCCATGAGTTTGTGGTGAAAGCTGTGCAGCAGTACCCAGAGAATGCAGCATTGCAGATCTCAGCGCTCAGCTGTTTGGCCCTCCTCACTGAGACTATTTTCTTAAATCAAGATTTAGAGGAAAAGAATGAGAATCAAGAGAATGATGATGAGGGGGAAGAAGATAAATTGTTTTGGCTGGAAGCCTGTTACAAAGCATTAACGTGGCATAGAAAGAACAAGCACGTGCAGGAGGCCGCATGCTGGGCACTAAATAATCTCCTTATGTACCAAAACAGTTTACATGAGAAGATTGGAGATGAAGATGGCCATTTCCCAGCTCATAGGGAAGTGATGCTCTCCATGCTGATGCATTCTTCATCAAAGGAAGTTTTCCAGGCATCTGCGAATGCATTGTCAACTCTCTTAGAACAAAATGTTAATTTCAGAAAAATACTGTTATCAAAAGGAATACACCTGAATGTTTTGGAGTTAATGCAGAAGCATATACATTCTCCTGAAGTGGCTGAAAGTGGCTGTAAAATGCTAAATCATCTTTTTGAAGGAAGCAACACTTCCCTGGATATAATGGCAGCAGTGGTCCCCAAAATACTAACAGTTATGAAACGTCATGAGACATCATTACCAGTGCAGCTGGAGGCGCTTCGAGCTATTTTACATTTTATAGTGCCTGGCATGCCAGAAGAATCCAGGGAGGATACAGAATTTCATCATAAGCTAAATATGGTTAAAAAACAGTGTTTCAAGAATGATATTCACAAACTGGTCCTAGCAGCTTTGAACAGGTTCATTGGAAATCCTGGGATTCAGAAATGTGGATTAAAAGTAATTTCTTCTATTGTACATTTTCCTGATGCATTAGAGATGTTATCCCTGGAAGGTGCTATGGATTCAGTGCTTCACACACTGCAGATGTATCCAGATGACCAAGAAATTCAGTGTCTGGGTTTAAGTCTTATAGGATACTTGATTACAAAGAAGAATGTGTTCATAGGAACTGGACATCTGCTGGCAAAAATTCTGGTTTCCAGCTTATACCGATTTAAGGATGTTGCTGAAATACAGACTAAAGGATTTCAGACAATCTTAGCAATCCTCAAATTGTCAGCATCTTTTTCTAAGCTGCTGGTGCATCATTCATTTGACTTAGTAATATTCCATCAAATGTCTTCCAATATCATGGAACAAAAGGATCAACAGTTTCTAAACCTCTGTTGCAAGTGTCTGGCAAAAGTAGCTATGGATGATTACTTAAAAAATGTGATGCTAGAGAGAGCGTGTGATCAGAATAACAGCATCATGGTTGAATGCTTGCTTCTATTGGGAGCAGATGCCAATCAAGCAAAGGAGGGATCTTCTTTAATTTGTCAGGTATGTGAGAAAGAGAGCAGTCCCAAATTGGTGGAACTCTTACTGAATAGTGGATCTCGTGAACAAGATGTACGAAAAGCGTTGACGATAAGCATTGGGAAAGGTGACAGCCAGATCATCAGCTTGCTCTTAAGGAGGCTGGCCCTGGATGTGGCCAACAATAGCATTTGCCTTGGAGGATTTTGTATAGGAAAAGTTGAACCTTCTTGGCTTGGTCCTTTATTTCCAGATAAGACTTCTAATTTAAGGAAACAAACAAATATAGCATCTACACTAGCAAGAATGGTGATCAGATATCAGATGAAAAGTGCTGTGGAAGAAGGAACAGCCTCAGGCAGCGATGGAAATTTTTCTGAAGATGTGCTGTCTAAATTTGATGAATGGACCTTTATTCCTGACTCTTCTATGGACAGTGTGTTTGCTCAAAGTGATGACCTGGATAGTGAAGGAAGTGAAGGCTCATTTCTTGTGAAAAAGAAATCTAATTCAATTAGTGTAGGAGAATTTTACCGAGATGCCGTATTACAGCGTTGCTCACCAAATTTGCAAAGACATTCCAATTCCTTGGGGCCCATTTTTGATCATGAAGATTTACTGAAGCGAAAAAGAAAAATACTATCTTCAGATGATTCACTCAGGTCATCAAAACTTCAATCCCATATGAGGCATTCAGACAGCATTTCTTCTCTGGCTTCTGAGAGAGAATATATTACATCACTAGACCTTTCAGCAAATGAACTAAGAGATATTGATGCCCTAAGCCAGAAATGCTGTATAAGTGTTCATTTGGAGCATCTTGAAAAGCTGGAGCTTCACCAGAATGCACTCACGAGCTTTCCACAACAGCTATGTGAAACTCTGAAGAGTTTGACACATTTGGACTTGCACAGTAATAAATTTACATCATTTCCTTCTTATTTGTTGAAAATGAGTTGTATTGCTAATCTTGATGTCTCTCGAAATGACATTGGACCCTCAGTGGTTTTAGATCCTACAGTGAAATGTCCAACTCTGAAACAGTTTAACCTGTCATATAACCAGCTGTCTTTTGTACCTGAGAACCTCACTGATGTGGTAGAGAAACTGGAGCAGCTCATTTTAGAAGGAAATAAAATATCAGGGATATGCTCCCCCTTGAGACTGAAGGAACTGAAGATTTTAAACCTTAGTAAGAACCACATTTCATCCCTATCAGAGAACTTTCTTGAGGCTTGTCCTAAAGTGGAGAGTTTCAGTGCCAGAATGAATTTTCTTGCTGCTATGCCTTTCTTGCCTCCTTCTATGACAATCCTAAAATTATCTCAGAACAAATTTTCCTGTATTCCAGAAGCAATTTTAAATCTTCCACACTTGCGGTCTTTAGATATGAGCAGCAATGATATTCAGTACCTACCAGGTCCCGCACACTGGAAATCTTTGAACTTAAGGGAACTCTTATTTAGCCATAATCAGATCAGCATCTTGGACTTGAGTGAAAAAGCATATTTATGGTCTAGAGTAGAGAAACTGCATCTTTCTCACAATAAACTGAAAGAGATTCCTCCTGAGATTGGCTGTCTTGAAAATCTGACATCTCTGGATGTCAGTTACAACTTGGAACTAAGATCCTTTCCCAATGAAATGGGGAAATTAAGCAAAATATGGGATCTTCCTTTGGATGAACTGCATCTTAACTTTGATTTTAAACATATAGGATGTAAAGCCAAAGACATCATAAGGTTTCTTCAACAGCGATTAAAAAAGGCTGTGCCTTATAACCGAATGAAACTTATGATTGTGGGAAATACTGGGAGTGGTAAAACCACCTTATTGCAGCAATTAATGAAAACCAAGAAATCAGATCTTGGAATGCAAAGTGCCACAGTTGGCATAGATGTGAAAGACTGGCCTATCCAAATAAGAGACAAAAGAAAGAGAGATCTCGTCCTAAATGTGTGGGATTTTGCAGGTCGTGAGGAATTCTATAGTACTCATCCCCATTTTATGACGCAGCGAGCATTGTACCTTGCTGTCTATGACCTCAGCAAGGGACAGGCTGAAGTTGATGCCATGAAGCCTTGGCTCTTCAATATAAAGGCTCGCGCTTCTTCTTCCCCTGTGATTCTCGTTGGCACACATTTGGATGTTTCTGATGAGAAGCAACGCAAAGCCTGCATGAGTAAAATCACCAAGGAACTCCTGAATAAGCGAGGGTTCCCTGCCATACGAGATTACCACTTTGTGAATGCCACCGAGGAATCTGATGCTTTGGCAAAACTTCGGAAAACCATCATAAACGAGAGCCTTAATTTCAAGATCCGAGATCAGCTTGTTGTTGGACAGCTGATTCCAGACTGCTATGTAGAACTTGAAAAAATCATTTTATCGGAGCGTAAAAATGTGCCAATTGAATTTCCCGTAATTGACCGGAAACGATTATTACAACTAGTGAGAGAAAATCAGCTGCAGTTAGATGAAAATGAGCTTCCTCACGCAGTTCACTTTCTAAATGAATCAGGAGTCCTTCTTCATTTTCAAGACCCAGCACTGCAGTTAAGTGACTTGTACTTTGTGGAACCCAAGTGGCTTTGTAAAATCATGGCACAGATTTTGACAGTGAAAGTGGAAGGTTGTCCAAAACACCCTAAGGGAATTATTTCGCGTAGAGATGTGGAAAAATTTCTTTCAAAGAAAAGGAAATTTCCAAAGAACTACATGACACAGTATTTTAAGCTCCTAGAAAAATTCCAGATTGCTTTGCCAATAGGAGAAGAATATTTGCTGGTTCCAAGCAGTTTGTCTGACCACAGGCCTGTGATAGAGCTTCCCCATTGTGAGAACTCTGAAATTATCATCCGACTATATGAAATGCCTTATTTTCCAATGGGATTTTGGTCAAGATTAATCAATCGATTACTTGAGATTTCACCTTACATGCTTTCAGGGAGAGAACGAGCACTTCGCCCAAACAGAATGTATTGGCGACAAGGCATTTACTTAAATTGGTCTCCTGAAGCTTATTGTCTGGTAGGATCTGAAGTCTTAGACAATCATCCAGAGAGTTTCTTAAAAATTACAGTTCCTTCTTGTAGAAAAGGCTGTATTCTTTTGGGCCAAGTTGTGGACCACATTGATTCTCTCATGGAAGAATGGTTTCCTGGGTTGCTGGAGATTGATATTTGTGGTGAAGGAGAAACTCTGTTGAAGAAATGGGCATTATATAGTTTTAATGATGGTGAAGAACATCAAAAAATCTTACTTGATGACTTGATGAAGAAAGCAGAGGAAGGAGATCTCTTAGTAAATCCAGATCAACCAAGGCTCACCATTCCAATATCTCAGATTGCCCCTGACTTGATTTTGGCTGACCTGCCTAGAAATATTATGTTGAATAATGATGAGTTGGAATTTGAACAAGCTCCAGAGTTTCTCCTAGGTGATGGCAGTTTTGGATCAGTTTACCGAGCAGCCTATGAAGGAGAAGAAGTGGCTGTGAAGATTTTTAATAAACATACATCACTCAGGCTGTTAAGACAAGAGCTTGTGGTGCTTTGCCACCTCCACCACCCCAGTTTGATATCTTTGCTGGCAGCTGGGATTCGTCCCCGGATGTTGGTGATGGAGTTAGCCTCCAAGGGTTCCTTGGATCGCCTGCTTCAGCAGGACAAAGCCAGCCTCACTAGAACCCTACAGCACAGGATTGCACTCCACGTAGCTGATGGTTTGAGATACCTCCACTCAGCCATGATTATATACCGAGACCTGAAACCCCACAATGTGCTGCTTTTCACACTGTATCCCAATGCTGCCATCATTGCAAAGATTGCTGACTACGGCATTGCTCAGTACTGCTGTAGAATGGGGATAAAAACATCAGAGGGCACACCAGGGTTTCGTGCACCTGAAGTTGCCAGAGGAAATGTCATTTATAACCAACAGGCTGATGTTTATTCATTTGGTTTACTACTCTATGACATTTTGACAACTGGAGGTAGAATAGTAGAGGGTTTGAAGTTTCCAAATGAGTTTGATGAATTAGAAATACAAGGAAAATTACCTGATCCAGTTAAAGAATATGGTTGTGCCCCATGGCCTATGGTTGAGAAATTAATTAAACAGTGTTTGAAAGAAAATCCTCAAGAAAGGCCTACTTCTGCCCAGGTCTTTGACATTTTGAATTCAGCTGAATTAGTCTGTCTGACGAGACGCATTTTATTACCTAAAAACGTAATTGTTGAATGCATGGTTGCTACACATCACAACAGCAGGAATGCAAGCATTTGGCTGGGCTGTGGGCACACCGACAGAGGACAGCTCTCATTTCTTGACTTAAATACTGAAGGATACACTTCTGAGGAAGTTGCTGATAGTAGAATATTGTGCTTAGCCTTGGTGCATCTTCCTGTTGAAAAGGAAAGCTGGATTGTGTCTGGGACACAGTCTGGTACTCTCCTGGTCATCAATACCGAAGATGGGAAAAAGAGACATACCCTAGAAAAGATGACTGATTCTGTCACTTGTTTGTATTGCAATTCCTTTTCCAAGCAAAGCAAACAAAAAAATTTTCTTTTGGTTGGAACCGCTGATGGCAAGTTAGCAATTTTTGAAGATAAGACTGTTAAGCTTAAAGGAGCTGCTCCTTTGAAGATACTAAATATAGGAAATGTCAGTACTCCATTGATGTGTTTGAGTGAATCCACAAATTCAACGGAAAGAAATGTAATGTGGGGAGGATGTGGCACAAAGATTTTCTCCTTTTCTAATGATTTCACCATTCAGAAACTCATTGAGACAAGAACAAGCCAACTGTTTTCTTATGCAGCTTTCAGTGATTCCAACATCATAACAGTGGTGGTAGACACTGCTCTCTATATTGCTAAGCAAAATAGCCCTGTTGTGGAAGTGTGGGATAAGAAAACTGAAAAACTCTGTGGACTAATAGACTGCGTGCACTTTTTAAGGGAGGTAATGGTAAAAGAAAACAAGGAATCAAAACACAAAATGTCTTATTCTGGGAGAGTGAAAACCCTCTGCCTTCAGAAGAACACTGCTCTTTGGATAGGAACTGGAGGAGGCCATATTTTACTCCTGGATCTTTCAACTCGTCGACTTATACGTGTAATTTACAACTTTTGTAATTCGGTCAGAGTCATGATGACAGCACAGCTAGGAAGCCTTAAAAATGTCATGCTGGTATTGGGCTACAACCGGAAAAATACTGAAGGTACACAAAAGCAGAAAGAGATACAATCTTGCTTGACCGTTTGGGACATCAATCTTCCACATGAAGTGCAAAATTTAGAAAAACACATTGAAGTGAGAAAAGAATTAGCTGAAAAAATGAGACGAACATCTGTTGAGTAAGAGAGAAATAGGCGGCCGC
Amino Acid Sequence: 
MDYKDDDDKGSMASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSEHASKLFQGKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLI EVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFE RVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLN EVHEFVVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIG DEDGHFPAHREVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILT VMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSV LHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQ QFLNLCCKCLAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISL LLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQ SDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASEREYITSLDL SANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFN LSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIP EAILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMG KLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLV LNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVN ATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPA LQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMTQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSE IIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLME EWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGS FGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAM IIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQ GKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGY TSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLK ILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDC VHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEI QSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE*
Price: £110.00
Completion Time: 
145
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Cost Centre: 
357.811501.R10
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.