FLAG

SLC35A2

cDNA Synonyms: 
CDG2M, CDGX, UDP-Gal-Tr, UGALT, UGAT, UGT, UGT1, UGT2, UGTL
DU Number: 
DU72995
Cost of Production: 
100.00
Plasmid: 
pBabeD hygro SLC35A2 2Flag (linker between flags)
Expressed: 
SLC35A2 2Flag
Genbank: 
NM_005660.3
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
4
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

RAPTOR

cDNA Synonyms: 
RPTOR
DU Number: 
DU72990
Plasmid: 
pCMV5 FLAG RAPTOR
Expressed: 
FLAG RAPTOR
Genbank: 
NP_065812
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
GGATCCCCGGAATTCGCCCTTATGCTGCAATCGCCTCTTCTGGGCCTGGGGGAGGAAGATGAGGCTGATCTTACAGACTGGAACCTACCTTTGGCTTTTATGAAAAAGAGGCACTGTGAGAAAATTGAAGGCTCCAAATCCTTAGCTCAGAGCTGGAGGATGAAGGATCGGATGAAGACAGTCAGTGTTGCCTTAGTTTTGTGCCTGAATGTTGGTGTGGACCCTCCCGATGTGGTGAAGACCACGCCCTGTGCACGCTTGGAATGCTGGATCGATCCTCTGTCGATGGGTCCTCAGAAAGCTCTGGAAACCATCGGTGCAAATTTACAGAAGCAGTACGAGAACTGGCAGCCAAGGGCCCGGTACAAGCAGAGCCTTGACCCAACTGTGGATGAAGTCAAGAAGCTCTGCACGTCCTTACGTCGCAACGCCAAGGAGGAGCGAGTCCTCTTTCACTACAATGGCCACGGGGTGCCCCGGCCCACAGTCAACGGGGAGGTCTGGGTCTTCAACAAGAACTACACGCAGTACATCCCTCTGTCCATATATGACCTGCAGACGTGGATGGGCAGCCCGTCGATCTTCGTCTACGACTGCTCCAATGCTGGCTTGATCGTCAAGTCCTTCAAGCAGTTCGCACTACAGCGGGAGCAGGAGCTGGAGGTAGCTGCAATCAACCCAAATCACCCTCTTGCTCAGATGCCTTTGCCTCCGTCGATGAAAAACTGCATCCAGCTGGCAGCCTGCGAGGCCACCGAGCTGCTGCCCATGATCCCCGACCTCCCGGCTGACCTATTCACCTCCTGCCTCACCACCCCCATCAAGATCGCCCTGCGCTGGTTTTGCATGCAGAAATGTGTCAGTCTGGTGCCTGGCGTCACACTGGATTTGATAGAAAAGATCCCTGGCCGCCTGAACGACAGGAGGACGCCCCTGGGTGAACTGAACTGGATCTTCACAGCCATCACAGACACCATCGCGTGGAACGTGCTCCCCCGGGATCTCTTCCAAAAGCTCTTCAGACAGGACTTGCTGGTGGCTAGTCTGTTTCGAAATTTTTTATTGGCGGAAAGGATTATGAGGTCGTATAACTGCACTCCCGTCAGCAGCCCGCGTCTGCCGCCCACGTACATGCACGCCATGTGGCAAGCCTGGGACCTGGCTGTTGACATCTGTCTGTCTCAGCTGCCGACGATCATCGAGGAAGGCACTGCGTTTCGGCACAGCCCGTTCTTCGCCGAGCAGCTGACCGCATTCCAGGTGTGGCTCACCATGGGCGTGGAGAACCGAAACCCACCCGAACAGCTGCCCATCGTCCTGCAGGTGCTGTTAAGCCAAGTGCACCGGCTGAGAGCATTGGACTTGCTTGGAAGATTTTTGGACCTGGGTCCCTGGGCAGTGAGCCTGGCCTTGTCTGTCGGCATCTTCCCCTACGTGCTGAAGCTGCTCCAGAGCTCGGCCCGAGAGCTGCGGCCACTTCTCGTTTTCATCTGGGCCAAGATCCTCGCAGTGGACAGCTCGTGCCAGGCGGACCTCGTGAAGGACAACGGCCACAAGTACTTCCTGTCGGTCCTGGCGGACCCCTACATGCCAGCTGAACACCGGACCATGACGGCTTTCATTCTCGCCGTGATCGTCAACAGCTATCACACGGGGCAGGAAGCCTGCCTTCAGGGAAACCTCATTGCCATCTGCCTGGAGCAGCTCAACGACCCGCACCCCTTGCTGCGCCAGTGGGTGGCCATCTGCCTCGGCAGGATCTGGCAGAACTTCGACTCGGCGAGGTGGTGCGGCGTGAGGGACAGCGCTCATGAGAAGCTCTACAGCCTCCTCTCCGACCCCATTCCCGAGGTCCGCTGCGCAGCGGTCTTCGCCCTTGGCACGTTCGTGGGCAACTCTGCAGAGAGGACGGACCACTCCACCACCATCGACCACAACGTGGCCATGATGCTGGCCCAGCTGGTCAGCGACGGGAGCCCCATGGTCCGGAAGGAGCTGGTGGTGGCTCTGAGTCATCTTGTGGTTCAGTATGAAAGCAATTTCTGCACCGTGGCCCTGCAGTTCATAGAAGAGGAAAAGAACTACGCCTTGCCTTCTCCAGCAACCACAGAGGGAGGGAGTTTGACCCCAGTGCGAGACAGCCCGTGCACCCCCAGACTTCGTTCTGTGAGCTCCTATGGAAACATCCGTGCTGTCGCCACAGCCAGGAGCCTCAACAAATCTTTGCAGAACCTGAGTTTGACAGAGGAATCTGGTGGCGCGGTGGCGTTCTCCCCCGGAAACCTCAGCACCAGCAGCAGCGCCAGCAGCACCCTGGGCAGCCCCGAGAATGAGGAGCATATCCTGTCCTTCGAGACCATCGACAAGATGCGCCGCGCCAGCTCCTACTCCTCCCTCAACTCCCTCATCGGAGTTTCCTTTAACAGTGTTTACACTCAGATTTGGAGAGTCCTGCTGCACCTGGCTGCTGACCCCTATCCAGAGGTCTCGGACGTGGCCATGAAAGTACTCAACAGCATCGCCTACAAGGCCACCGTGAACGCCCGGCCGCAGCGCGTCCTGGACACCTCCTCCCTCACGCAGTCGGCCCCCGCCAGCCCCACCAACAAGGGCGTGCACATCCACCAGGCGGGGGGCTCCCCTCCGGCGTCCAGCACCAGCAGCTCCAGCCTGACCAACGATGTGGCCAAGCAGCCGGTCAGCCGAGACTTGCCTTCTGGCCGGCCGGGCACCACAGGCCCCGCTGGGGCGCAGTACACCCCTCACTCCCACCAGTTCCCCCGGACACGGAAGATGTTCGACAAGGGCCCAGAGCAGACTGCGGACGACGCGGACGATGCTGCTGGACACAAAAGTTTCATCTCCGCCACGGTGCAGACGGGGTTCTGCGACTGGAGCGCCCGCTATTTTGCCCAGCCCGTCATGAAGATCCCAGAAGAGCACGACCTGGAGAGTCAGATCCGCAAGGAGCGGGAGTGGCGGTTCCTGCGAAACAGCCGTGTCAGGAGGCAGGCCCAGCAAGTCATTCAGAAGGGCATTACGAGATTGGACGACCAAATATTTCTGAACAGGAACCCCGGCGTCCCCTCTGTGGTGAAATTCCACCCCTTCACGCCGTGCATCGCTGTAGCCGACAAGGACAGCATCTGCTTTTGGGACTGGGAGAAAGGGGAGAAGCTGGATTATTTCCACAATGGGAACCCTCGGTACACGAGGGTCACTGCCATGGAGTATCTGAATGGCCAGGACTGCTCGCTTCTGCTGACGGCCACAGACGATGGTGCCATCAGGGTCTGGAAGAATTTTGCTGATTTGGAAAAGAACCCAGAGATGGTGACCGCGTGGCAGGGGCTCTCGGACATGCTGCCAACGACGCGAGGAGCTGGGATGGTGGTGGACTGGGAGCAGGAGACCGGCCTCCTCATGAGCTCAGGAGACGTGCGGATCGTCCGGATCTGGGACACAGACCGTGAGATGAAGGTGCAGGACATCCCTACGGGCGCAGACAGCTGTGTGACGAGTCTGTCCTGTGATTCCCACCGCTCACTCATCGTGGCTGGCCTCGGTGACGGCTCCATCCGCGTCTACGACAGAAGGATGGCACTCAGCGAATGCCGCGTCATGACGTACCGGGAGCACACAGCCTGGGTGGTGAAGGCCTCCCTGCAGAAGCGTCCCGACGGCCACATCGTGAGTGTGAGCGTCAATGGAGATGTGCGCATCTTTGATCCCCGGATGCCTGAGTCGGTAAATGTGCTTCAGATCGTGAAGGGGCTGACGGCCCTGGACATCCACCCCCAGGCGGACCTGATCGCATGTGGCTCCGTCAATCAGTTCACCGCCATCTACAACAGCAGCGGAGAGCTCATCAACAACATCAAGTACTACGACGGCTTCATGGGCCAGCGGGTCGGCGCCATCAGCTGCCTGGCCTTCCACCCGCACTGGCCTCACCTGGCCGTGGGAAGCAACGACTACTACATCTCCGTGTACTCGGTGGAGAAGCGTGTCAGATAGGAAGGGCGAATTCTGCAGTCGACGGTACC
Amino Acid Sequence: 
MDYKDDDDKGSPEFALMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSVSSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILSFETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYKATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR*EGRILQSTVPRARYRPDLDN*SI
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
Yes
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
Mel Wightman

ALPK1

cDNA Synonyms: 
*
DU Number: 
DU71485
Cost of Production: 
175.00
Plasmid: 
pcDNA5D FRT TO (Ubc Pr)-FLAG-ALPK1 T237E F295K
Expressed: 
FLAG-ALPK1 T237E F295K
Genbank: 
NM_025144.4 → NP_079420.3 GI: 1519314014
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
see attached Snapgene file
Amino Acid Sequence: 
MDYKDDDDKGSMNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSESLGILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAEACKLAAAFSAYTPLKVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTGKQELHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQVQSFSNVDDRSYVPESFECRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNEQKDAKTGVCITALKTEIKNIDTVSTTQEKPHCQRDTGISSSLMGKNVQRELRRGGRRNWTHSDAFRVSLDQDVETETEPSDYSNGEGAVFNKSLSGSQTSSAWSNLSGFSSSASWEEVNYHVDDRSARKEPGKEHLVDTQCSTALSEELENDREGRAMHSLHSQLHDLSLQEPNNDNLEPSQNQPQQQMPLTPFSPHNTPGIFLAPGAGLLEGAPEGIQEVRNMGPRNTSAHSRPSYRSASWSSDSGRPKNMGTHPSVQKEEAFEIIVEFPETNCDVKDRQGKEQGEEISERGAGPTFKASPSWVDPEGETAESTEDAPLDFHRVLHNSLGNISMLPCSSFTPNWPVQNPDSRKSGGPVAEQGIDPDASTVDEEGQLLDSMDVPCTNGHGSHRLCILRQPPGQRAETPNSSVSGNILFPVLSEDCTTTEEGNQPGNMLNCSQNSSSSSVWWLKSPAFSSGSSEGDSPWSYLNSSGSSWVSLPGKMRKEILEARTLQPDDFEKLLAGVRHDWLFQRLENTGVFKPSQLHRAHSALLLKYSKKSELWTAQETIVYLGDYLTVKKKGRQRNAFWVHHLHQEEILGRYVGKDYKEQKGLWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLIYLTDPQIHSVDQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKPCT*
Sequence of Full plasmid: 
see attached Snapgene file
Price: £125.00
Completion Time: 
44
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
117454
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2213
Budget Centre: 
1046
Nominal Code: 
35907

LRRK2

cDNA Synonyms: 
PARK8; RIPK7; ROCO2; AURA17; DARDARIN
DU Number: 
DU72932
Cost of Production: 
150.00
Plasmid: 
pCMV5 FLAG LRRK2 D154A E155G E156A N551K
Expressed: 
FLAG LRRK2 D154A E155G E156A N551K
Genbank: 
NM_198578.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
46
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
Yes
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

LRRK2

cDNA Synonyms: 
PARK8; RIPK7; ROCO2; AURA17; DARDARIN
DU Number: 
DU72941
Cost of Production: 
150.00
Plasmid: 
pCMV5 FLAG LRRK2 R767H Y1699C G2019S
Expressed: 
FLAG LRRK2 R767H Y1699C G2019S
Genbank: 
NM_198578.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
10
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
Yes
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

LRRK2

cDNA Synonyms: 
PARK8; RIPK7; ROCO2; AURA17; DARDARIN
DU Number: 
DU72947
Cost of Production: 
150.00
Plasmid: 
pCMV5 Flag LRRK2 Y1699S
Expressed: 
Flag LRRK2 Y1699S
Genbank: 
NM_198578.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
30
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
118922
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2585
Budget Centre: 
1046
Nominal Code: 
35907

TSC22D4

cDNA Synonyms: 
THG1; THG-1; TILZ2
DU Number: 
DU61975
Cost of Production: 
100.00
Plasmid: 
pCMV5D FLAG TSC22D4 M1-N320
Expressed: 
FLAG TSC22D4 M1-N320
Genbank: 
NM_030935
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MDYKDDDDKGSMSGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPDPGGKGTPRNGSPPPGAPSSRFRVVKLPHGLGEPYRRGR WTCVDVYERDLEPHSFGGLLEGIRGASGGAGGRSLDSRLELASLGLGAPTPPSGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLVVPSKAKAEKPPLSAS SPQQRPPEPETGESAGTSRAATPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSPDPFGAVAAQ KFSLAHSMLAISGHLDSDDDSGSGSLVGIDN*
Price: £125.00
Completion Time: 
17
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
117609
Project Type: 
D
Budget Group: 
C004
Funder Code: 
1673
Budget Centre: 
1046
Nominal Code: 
35907

TSC22D2

cDNA Synonyms: 
TILZ4a; TILZ4b; TILZ4c
DU Number: 
DU61990
Cost of Production: 
110.00
Plasmid: 
pCMV5D FLAG TSC22D2 M1-I690
Expressed: 
FLAG TSC22D2 M1-I690
Genbank: 
NM_014779.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MDYKDDDDKGSMSKMPAKKKSCFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPEEVCERSSSEETLNNVGDAETPGTVSPNLL LDGQLAAAAAAPANGGGVVSARSVSGALASTLAAAATSAPAPGAPGGPQLAGSSAGPVTAAPSQPPTTCSSRFRVIKLDHGSGEPYRRGRWTCMEYYERD SDSSVLTRSGDCIRHSSTFDQTAERDSGLGATGGSVVVVVASMQGAHGPESGTDSSLTAVSQLPPSEKMSQPTPAQPQSFSVGQPQPPPPPVGGAVAQSS APLPPFPGAATGPQPMMAAAQPSQPQGAGPGGQTLPPTNVTLAQPAMSLPPQPGPAVGAPAAQQPQQFAYPQPQIPPGHLLPVQPSGQSEYLQQHVAGLQ PPSPAQPSSTGAAASPATAATLPVGTGQNASSVGAQLMGASSQPSEAMAPRTGPAQGGQVAPCQPTGVPPATVGGVVQPCLGPAGAGQPQSVPPPQMGGS GPLSAVPGGPHAVVPGVPNVPAAVPAPSVPSVSTTSVTMPNVPAPLAQSQQLSSHTPVSRSSSIIQHVGLPLAPGTHSAPTSLPQSDLSQFQTQTQPLVG QVDDTRRKSEPLPQPPLSLIAENKPVVKPPVADSLANPLQLTPMNSLATSVFSIAIPVDGDEDRNPSTAFYQAFHLNTLKESKSLWDSASGGGVVAIDNK I*
Price: £125.00
Completion Time: 
28
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
None
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
117609
Project Type: 
D
Budget Group: 
C004
Funder Code: 
1673
Budget Centre: 
1046
Nominal Code: 
35907

NRBP2

cDNA Synonyms: 
NRBP2
DU Number: 
DU72945
Cost of Production: 
100.00
Plasmid: 
pCMV5D Flag NRBP2
Expressed: 
Flag NRBP2
Genbank: 
NM_178564.4
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
See snapgene file
Price: £125.00
Completion Time: 
11
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
117609
Project Type: 
D
Budget Group: 
C004
Funder Code: 
1673
Budget Centre: 
1046
Nominal Code: 
35907

ALPK1

cDNA Synonyms: 
*
DU Number: 
DU71482
Plasmid: 
pcDNA5D FRT TO (Ubc Pr)-FLAG-ALPK1 F295K
Expressed: 
FLAG-ALPK1 F295K
Genbank: 
NM_025144.4 → NP_079420.3 GI: 1519314014
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Sequence of Insert: 
see attached Snapgene file
Amino Acid Sequence: 
MDYKDDDDKGSMNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAEACKLAAAFSAYTPLKVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTGKQELHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQVQSFSNVDDRSYVPESFECRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNEQKDAKTGVCITALKTEIKNIDTVSTTQEKPHCQRDTGISSSLMGKNVQRELRRGGRRNWTHSDAFRVSLDQDVETETEPSDYSNGEGAVFNKSLSGSQTSSAWSNLSGFSSSASWEEVNYHVDDRSARKEPGKEHLVDTQCSTALSEELENDREGRAMHSLHSQLHDLSLQEPNNDNLEPSQNQPQQQMPLTPFSPHNTPGIFLAPGAGLLEGAPEGIQEVRNMGPRNTSAHSRPSYRSASWSSDSGRPKNMGTHPSVQKEEAFEIIVEFPETNCDVKDRQGKEQGEEISERGAGPTFKASPSWVDPEGETAESTEDAPLDFHRVLHNSLGNISMLPCSSFTPNWPVQNPDSRKSGGPVAEQGIDPDASTVDEEGQLLDSMDVPCTNGHGSHRLCILRQPPGQRAETPNSSVSGNILFPVLSEDCTTTEEGNQPGNMLNCSQNSSSSSVWWLKSPAFSSGSSEGDSPWSYLNSSGSSWVSLPGKMRKEILEARTLQPDDFEKLLAGVRHDWLFQRLENTGVFKPSQLHRAHSALLLKYSKKSELWTAQETIVYLGDYLTVKKKGRQRNAFWVHHLHQEEILGRYVGKDYKEQKGLWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLIYLTDPQIHSVDQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKPCT*
Sequence of Full plasmid: 
see attached Snapgene file
Price: £125.00
Completion Time: 
17
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No
Cost Centre: 
Project Code: 
117454
Project Type: 
D
Budget Group: 
C001
Funder Code: 
2213
Budget Centre: 
1046
Nominal Code: 
35907

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.