GST

TSC22D3 (1 - 200)

Long Name: 
TSC22 domain family member 3
Accession: 
NM_198057
Catalog Number (DU Number): 
DU61978
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
49, 005.64 daltons
Average Mass: 
49, 037.34 daltons
Theoretical PI: 
5.21
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-80 deg C
Native Sequence: 
Amino acids M1 – V200 (end) of human TSCC2D3. Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 - 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 – 228.
Cloning Sites: 
BamH1 and Not1 sites of pGEX6P-1
Price: £125.00
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Wednesday, 4 September, 2019 - 11
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No

PPM1D (1 - 605)

Long Name: 
protein phosphatase, Mg2+/Mn2+ dependent 1D
Accession: 
NM_003620.4
Catalog Number (DU Number): 
DU32201
Protein Activity: 
Expression: 
Purification Method: 
GSH Agarose
Mono-Isotopic Mass: 
94, 417.99 daltons
Average Mass: 
94, 478.37 daltons
Theoretical PI: 
8.67
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 150 mM NaCl, 270 mM sucrose, 2 mM MnCl2, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-80 deg C
Native Sequence: 
Amino acids M1 – C605 (end) of human PPM1D. Residue M243 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 - 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 - 229
Cloning Sites: 
Not1 sites of pGEX6P-2
Target Family: 
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Clone reference: 
Protein Complete: 
No
Protein Date Complete: 
Wednesday, 4 September, 2019 - 11
Auto Generated: 
Yes
Final Product: 
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No

NEDD4L (2 - 854)

Long Name: 
NEDD4 like E3 ubiquitin protein ligase
Accession: 
Q96PU5-4
Catalog Number (DU Number): 
DU8073
Expression: 
Purification Method: 
GSH-Agarose
Purity: 
>85 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-70 deg C
Native Sequence: 
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 - 229
Cloning Sites: 
Not1 site of pGex6P-1
Research Area: 
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Tuesday, 6 September, 2022 - 13
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
Yes

NEDD4 (1 - 900)

Long Name: 
NEDD4 E3 ubiquitin protein ligase
Accession: 
P46934-4
Catalog Number (DU Number): 
DU24979
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
130, 958.74 daltons
Average Mass: 
131, 041.18 daltons
Theoretical PI: 
5.68
Purity: 
>85 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-70 deg C
Native Sequence: 
Amino acids M1 – D900 (end) of human NEDD4. Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 - 229
Cloning Sites: 
BamH1 and Not1 site of pGex6P-1
Research Area: 
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Tuesday, 6 September, 2022 - 13
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
Yes

eIF2S2 (1 - 333)

Long Name: 
eukaryotic translation initiation factor 2 subunit beta
Accession: 
NM_003908.5
Catalog Number (DU Number): 
DU68476
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
65, 171.01 daltons
Average Mass: 
65, 212.57 daltons
Theoretical PI: 
5.66
Purity: 
>75 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-70 deg C
Native Sequence: 
Amino acids M1 – N333 (end) of human eIF2S2. Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 - 229
Cloning Sites: 
BamH1 and Not1 site of pGex6P-1
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Friday, 2 September, 2022 - 11
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No

eIF2S1 (1 - 315)

Long Name: 
eukaryotic translation initiation factor 2 subunit alpha
Accession: 
NM_004094.5
Catalog Number (DU Number): 
DU68477
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
62, 896.01 daltons
Average Mass: 
62, 936.33 daltons
Theoretical PI: 
5.23
Purity: 
>85 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-70 deg C
Native Sequence: 
Amino acids M1 – D315 (end) of human eIF2S1. Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 - 229
Cloning Sites: 
BamH1 and Not1 site of pGex6P-1
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Friday, 2 September, 2022 - 11
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No

53BP1 (1 - 500)

Long Name: 
tumor protein p53 binding protein 1
Accession: 
NM_001141980.3
Catalog Number (DU Number): 
DU11191
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
80, 637.27 daltons
Average Mass: 
80, 687.58 daltons
Theoretical PI: 
4.51
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-80 deg C
Native Sequence: 
Amino acids M1 – S500 of human 53BP1 (end residue is H1972) Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 and Not1 sites of pGEX6P-1
Price: £125.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Thursday, 24 May, 2018 - 11
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No

TSC22D3

cDNA Synonyms: 
DIP; GILZ; DSIPI; TSC-22R
DU Number: 
DU61978
Cost of Production: 
100.00
Plasmid: 
pGEX6P1 TSC22D3
Expressed: 
GST 3C TSC22D3
Genbank: 
NM_198057
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIM RQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFHSASGASVVAIDNKIEQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASP EQLEKFQSCLSPEEPAPESPQVPEAPGGSAV*
Price: £125.00
Completion Time: 
8
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
PreScission
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No

TSC22D1

cDNA Synonyms: 
Ptg-2; TSC22; TGFB1I4
DU Number: 
DU61985
Cost of Production: 
175.00
Plasmid: 
pGEX6P1 TSC22D1
Expressed: 
GST 3C TSC22D1
Genbank: 
NM_183422.3
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Amino Acid Sequence: 
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMHQPPESTAAAAAAADISARKMAHPAMFPRRGSGSGSASALNAAGTGVGSNATSSEDFPPPSLLQPPPP AASSTSGPQPPPPQSLNLLSQAQLQAQPLAPGGTQMKKKSGFQITSVTPAQISASISSNNSIAEDTESYDDLDESHTEDLSSSEILDVSLSRATDLGEPE RSSSEETLNNFQEAETPGAVSPNQPHLPQPHLPHLPQQNVVINGNAHPHHLHHHHQIHHGHHLQHGHHHPSHVAVASASITGGPPSSPVSRKLSTTGSSD SITPVAPTSAVSSSGSPASVMTNMRAPSTTGGIGINSVTGTSTVNNVNITAVGSFNPNVTSSMLGNVNISTSNIPSAAGVSVGPGVTSGVNVNILSGMGN GTISSSAAVSSVPNAAAGMTGGSVSSQQQQPTVNTSRFRVVKLDSSSEPFKKGRWTCTEFYEKENAVPATEGVLINKVVETVKQNPIEVTSERESTSGSS VSSSVSTLSHYTESVGSGEMGAPTVVVQQQQQQQQQQQQQPALQGVTLQQMDFGSTGPQSIPAVSIPQSISQSQISQVQLQSQELSYQQKQGLQPVPLQA TMSAATGIQPSPVNVVGVTSALGQQPSISSLAQPQLPYSQAAPPVQTPLPGAPPPQQLQYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSS GQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQPVGQAPAAVSAVPTGSQIANIGQQANIPTAVQQPSTQVPPSVIQQGAPPSSQVVPPAQ TGIIHQGVQTSAPSLPQQLVIASQSSLLTVPPQPQGVEPVAQGIVSQQLPAVSSLPSASSISVTSQVSSTGPSGMPSAPTNLVPPQNIAQTPATQNGNLV QSVSQPPLIATNTNLPLAQQIPLSSTQFSAQSLAQAIGSQIEDARRAAEPSLVGLPQTISGDSGGMSAVSDGSSSSLAASASLFPLKVLPLTTPLVDGED ESSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGS GPTA*
Price: £125.00
Completion Time: 
9
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Full Snapgene Map: 
Extra Protein: 
No
Cleavage Site: 
PreScission
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
No

UBA3; APPBP1

cDNA Synonyms: 
UBA3, Ubiquitin-Activating Enzyme E1 Homolog
DU Number: 
DU61958
Plasmid: 
pOPC UBA3 6His, GST APPBP1
Expressed: 
UBA3 6His, GST APPBP1
Genbank: 
NP_003959.3, NP_003896
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Sequence of Insert: 
DNA sequence of UBA3 insert TCTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATATACATATGGCGGA TGGCTGTTGATGGTGGGTGTGGGGACACTGGAGACTGGGAAGGTCGCTGG AACCATGTAAAGAAGTTCCTCGAGCGATCTGGACCCTTCACACACCCTGA TTTCGAACCGAGCACTGAATCTCTCCAGTTCTTGTTAGATACATGTAAAG TTCTAGTCATTGGAGCTGGCGGCTTAGGATGTGAGCTCCTGAAAAATCTG GCCTTGTCTGGTTTTAGACAGATTCATGTTATAGATATGGACACTATAGA TGTTTCCAATCTAAATAGGCAGTTTTTATTTAGGCCTAAAGATATTGGAA GACCTAAGGCTGAAGTTGCTGCAGAATTTCTAAATGACAGAGTTCCTAAT TGCAATGTAGTTCCACATTTCAACAAGATTCAAGATTTTAACGACACTTT CTATCGACAATTTCATATTATTGTATGTGGACTGGACTCTATCATCGCCA GAAGATGGATAAATGGCATGCTGATATCTCTTCTAAATTATGAAGATGGT GTCTTAGATCCAAGCTCCATTGTCCCTTTGATAGATGGGGGGACAGAAGG TTTTAAAGGAAATGCCCGGGTGATTCTGCCTGGAATGACTGCTTGTATCG AATGCACGCTGGAACTTTATCCACCACAGGTTAATTTTCCCATGTGCACC ATTGCATCTATGCCCAGGCTACCAGAACACTGTATTGAGTATGTAAGGAT GTTGCAGTGGCCTAAGGAGCAGCCTTTTGGAGAAGGGGTTCCATTAGATG GAGATGATCCTGAACATATACAATGGATTTTCCAAAAATCCCTAGAGAGA GCATCACAATATAATATTAGGGGTGTTACGTATAGGCTCACTCAAGGGGT AGTAAAAAGAATCATTCCTGCAGTAGCTTCCACAAATGCAGTCATTGCAG CTGTGTGTGCCACTGAGGTTTTTAAAATAGCCACAAGTGCATACATTCCC TTGAATAATTACTTGGTGTTTAATGATGTAGATGGGCTGTATACATACAC ATTTGAAGCAGAAAGAAAGGAAAACTGCCCAGCTTGTAGCCAGCTTCCTC AAAATATTCAGTTTTCTCCATCAGCTAAACTACAGGAGGTTTTGGATTAT CTAACCAATAGTGCTTCTCTGCAAATGAAATCTCCAGCCATCACAGCCAC CCTAGAGGGAAAAAATAGAACACTTTACTTACAGTCGGTAACCTCTATTG AAGAACGAACAAGGCCAAATCTCTCCAAAACATTGAAAGAATTGGGGCTT GTTGATGGACAAGAACTGGCGGTTGCTGATGTCACCACCCCACAGACTGT ACTATTCAAACTTCATTTTACTTCTCATCATCACCATCACCATTAAGGAT CC DNA sequence of GST APPBP1 CAATTGAATAATTTTGTTTAACTTTAAGAAGGAGATATACATATGTCCCC TATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCACTCGACTTC TTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATGAGCGCGAT GAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTGGAGTTTCC CAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACAGTCTATGG CCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTGGTTGTCCA AAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTGGATATTAG ATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAACTCTCAAAG TTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCGAAGATCGT TTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCATCCTGACTT CATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCCAATGTGCC TGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTGAAGCTATC CCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCATGGCCTTT GCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCCAAAATCGG ATCTGGTTCCGCGTGGATCCATGGCGCAGCTGGGAAAGCTGCTCAAGGAG CAGAAGTACGACCGGCAGCTGAGGTTGTGGGGTGATCATGGGCAAGAGGC TTTAGAATCTGCTCATGTTTGCCTAATAAATGCAACAGCCACAGGAACTG AAATTCTTAAAAACTTGGTACTACCAGGTATTGGTTCGTTTACAATTATT GATGGAAATCAGGTCAGCGGAGAAGATGCTGGAAACAATTTCTTCCTTCA AAGAAGCAGTATCGGCAAGAACCGAGCTGAAGCTGCCATGGAATTCTTAC AAGAATTAAATAGCGATGTCTCTGGAAGTTTTGTGGAAGAGAGTCCAGAA AACCTTCTAGACAATGATCCCTCATTTTTCTGTAGGTTTACTGTTGTAGT TGCAACTCAGCTTCCTGAAAGCACTTCACTACGCTTAGCAGATGTCCTCT GGAATTCCCAGATTCCTCTTTTGATCTGTAGGACATATGGACTAGTTGGT TATATGAGGATCATTATAAAAGAACATCCAGTAATAGAATCTCATCCAGA TAATGCATTAGAGGATCTACGACTAGATAAGCCATTTCCTGAACTGAGAG AACATTTTCAGTCCTATGATTTGGATCATATGGAAAAAAAGGACCACAGT CATACTCCATGGATTGTGATCATAGCTAAATATTTAGCACAGTGGTATAG TGAAACAAATGGACGAATACCTAAAACGTATAAAGAAAAAGAGGACTTCA GAGATTTGATTAGACAAGGAATTCTAAAAAATGAAAATGGGGCTCCAGAA GATGAAGAGAATTTTGAAGAAGCTATTAAAAATGTGAACACAGCACTAAA TACAACTCAGATCCCAAGCAGTATTGAAGATATATTTAATGATGATCGCT GCATAAATATCACCAAACAGACTCCATCATTTTGGATTTTAGCTCGTGCC TTAAAGGAATTTGTGGCCAAAGAGGGTCAAGGAAATTTACCTGTTCGAGG CACAATTCCTGATATGATTGCAGATTCAGGCAAATATATAAAACTGCAAA ACGTTTACCGTGAAAAAGCAAAGAAAGATGCTGCCGCTGTGGGTAATCAT GTTGCCAAATTGCTGCAGTCCATTGGCCAGGCACCAGAGTCCATTTCAGA GAAAGAATTAAAATTACTCTGCAGCAATTCTGCATTTCTTCGAGTGGTAA GATGTCGATCCTTAGCTGAAGAATATGGTTTGGATACAATTAACAAGGAT GAAATTATTTCTAGCATGGACAATCCAGATAATGAAATAGTGTTGTACTT AATGTTACGGGCTGTTGATAGATTTCATAAACAACAGGGTAGATATCCAG GAGTATCTAACTATCAAGTTGAAGAAGATATAGGAAAGTTGAAGTCTTGT CTCACTGGCTTCCTTCAGGAATATGGTTTATCTGTAATGGTGAAAGATGA TTATGTCCACGAATTTTGCCGATATGGAGCTGCTGAGCCACATACCATTG CTGCATTCTTGGGGGGAGCTGCTGCTCAAGAGGTCATCAAAATAATCACC AAACAATTTGTAATTTTTAATAATACTTACATTTACAGTGGCATGTCACA AACTTCAGCAACTTTCCAGTTGTAGAAGCTT
Amino Acid Sequence: 
Protein sequence of UBA3 MAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCK VLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIG RPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIA RRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACI ECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLD GDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIA AVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLP QNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSI EERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTSHHHHHH* Protein sequence of GST APPBP1 MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLVPRGSMAQLGKLLKEQKYDRQLRLWGDHG QEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNF FLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFT VVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIES HPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQ WYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNT ALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLP VRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPES ISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIV LYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMV KDDYVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSG MSQTSATFQL*
Price: £125.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Thrombin
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
Yes
Reagent Type: 

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.