GST

UBA3; APPBP1

cDNA Synonyms: 
UBA3, Ubiquitin-Activating Enzyme E1 Homolog
DU Number: 
DU61958
Plasmid: 
pOPC UBA3 6His, GST APPBP1
Expressed: 
UBA3 6His, GST APPBP1
Genbank: 
NP_003959.3, NP_003896
Species: 
Human
Vector Type: 
Bacterial
Tag: 
Sequence of Insert: 
DNA sequence of UBA3 insert TCTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATATACATATGGCGGA TGGCTGTTGATGGTGGGTGTGGGGACACTGGAGACTGGGAAGGTCGCTGG AACCATGTAAAGAAGTTCCTCGAGCGATCTGGACCCTTCACACACCCTGA TTTCGAACCGAGCACTGAATCTCTCCAGTTCTTGTTAGATACATGTAAAG TTCTAGTCATTGGAGCTGGCGGCTTAGGATGTGAGCTCCTGAAAAATCTG GCCTTGTCTGGTTTTAGACAGATTCATGTTATAGATATGGACACTATAGA TGTTTCCAATCTAAATAGGCAGTTTTTATTTAGGCCTAAAGATATTGGAA GACCTAAGGCTGAAGTTGCTGCAGAATTTCTAAATGACAGAGTTCCTAAT TGCAATGTAGTTCCACATTTCAACAAGATTCAAGATTTTAACGACACTTT CTATCGACAATTTCATATTATTGTATGTGGACTGGACTCTATCATCGCCA GAAGATGGATAAATGGCATGCTGATATCTCTTCTAAATTATGAAGATGGT GTCTTAGATCCAAGCTCCATTGTCCCTTTGATAGATGGGGGGACAGAAGG TTTTAAAGGAAATGCCCGGGTGATTCTGCCTGGAATGACTGCTTGTATCG AATGCACGCTGGAACTTTATCCACCACAGGTTAATTTTCCCATGTGCACC ATTGCATCTATGCCCAGGCTACCAGAACACTGTATTGAGTATGTAAGGAT GTTGCAGTGGCCTAAGGAGCAGCCTTTTGGAGAAGGGGTTCCATTAGATG GAGATGATCCTGAACATATACAATGGATTTTCCAAAAATCCCTAGAGAGA GCATCACAATATAATATTAGGGGTGTTACGTATAGGCTCACTCAAGGGGT AGTAAAAAGAATCATTCCTGCAGTAGCTTCCACAAATGCAGTCATTGCAG CTGTGTGTGCCACTGAGGTTTTTAAAATAGCCACAAGTGCATACATTCCC TTGAATAATTACTTGGTGTTTAATGATGTAGATGGGCTGTATACATACAC ATTTGAAGCAGAAAGAAAGGAAAACTGCCCAGCTTGTAGCCAGCTTCCTC AAAATATTCAGTTTTCTCCATCAGCTAAACTACAGGAGGTTTTGGATTAT CTAACCAATAGTGCTTCTCTGCAAATGAAATCTCCAGCCATCACAGCCAC CCTAGAGGGAAAAAATAGAACACTTTACTTACAGTCGGTAACCTCTATTG AAGAACGAACAAGGCCAAATCTCTCCAAAACATTGAAAGAATTGGGGCTT GTTGATGGACAAGAACTGGCGGTTGCTGATGTCACCACCCCACAGACTGT ACTATTCAAACTTCATTTTACTTCTCATCATCACCATCACCATTAAGGAT CC DNA sequence of GST APPBP1 CAATTGAATAATTTTGTTTAACTTTAAGAAGGAGATATACATATGTCCCC TATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCACTCGACTTC TTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATGAGCGCGAT GAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTGGAGTTTCC CAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACAGTCTATGG CCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTGGTTGTCCA AAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTGGATATTAG ATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAACTCTCAAAG TTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCGAAGATCGT TTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCATCCTGACTT CATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCCAATGTGCC TGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTGAAGCTATC CCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCATGGCCTTT GCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCCAAAATCGG ATCTGGTTCCGCGTGGATCCATGGCGCAGCTGGGAAAGCTGCTCAAGGAG CAGAAGTACGACCGGCAGCTGAGGTTGTGGGGTGATCATGGGCAAGAGGC TTTAGAATCTGCTCATGTTTGCCTAATAAATGCAACAGCCACAGGAACTG AAATTCTTAAAAACTTGGTACTACCAGGTATTGGTTCGTTTACAATTATT GATGGAAATCAGGTCAGCGGAGAAGATGCTGGAAACAATTTCTTCCTTCA AAGAAGCAGTATCGGCAAGAACCGAGCTGAAGCTGCCATGGAATTCTTAC AAGAATTAAATAGCGATGTCTCTGGAAGTTTTGTGGAAGAGAGTCCAGAA AACCTTCTAGACAATGATCCCTCATTTTTCTGTAGGTTTACTGTTGTAGT TGCAACTCAGCTTCCTGAAAGCACTTCACTACGCTTAGCAGATGTCCTCT GGAATTCCCAGATTCCTCTTTTGATCTGTAGGACATATGGACTAGTTGGT TATATGAGGATCATTATAAAAGAACATCCAGTAATAGAATCTCATCCAGA TAATGCATTAGAGGATCTACGACTAGATAAGCCATTTCCTGAACTGAGAG AACATTTTCAGTCCTATGATTTGGATCATATGGAAAAAAAGGACCACAGT CATACTCCATGGATTGTGATCATAGCTAAATATTTAGCACAGTGGTATAG TGAAACAAATGGACGAATACCTAAAACGTATAAAGAAAAAGAGGACTTCA GAGATTTGATTAGACAAGGAATTCTAAAAAATGAAAATGGGGCTCCAGAA GATGAAGAGAATTTTGAAGAAGCTATTAAAAATGTGAACACAGCACTAAA TACAACTCAGATCCCAAGCAGTATTGAAGATATATTTAATGATGATCGCT GCATAAATATCACCAAACAGACTCCATCATTTTGGATTTTAGCTCGTGCC TTAAAGGAATTTGTGGCCAAAGAGGGTCAAGGAAATTTACCTGTTCGAGG CACAATTCCTGATATGATTGCAGATTCAGGCAAATATATAAAACTGCAAA ACGTTTACCGTGAAAAAGCAAAGAAAGATGCTGCCGCTGTGGGTAATCAT GTTGCCAAATTGCTGCAGTCCATTGGCCAGGCACCAGAGTCCATTTCAGA GAAAGAATTAAAATTACTCTGCAGCAATTCTGCATTTCTTCGAGTGGTAA GATGTCGATCCTTAGCTGAAGAATATGGTTTGGATACAATTAACAAGGAT GAAATTATTTCTAGCATGGACAATCCAGATAATGAAATAGTGTTGTACTT AATGTTACGGGCTGTTGATAGATTTCATAAACAACAGGGTAGATATCCAG GAGTATCTAACTATCAAGTTGAAGAAGATATAGGAAAGTTGAAGTCTTGT CTCACTGGCTTCCTTCAGGAATATGGTTTATCTGTAATGGTGAAAGATGA TTATGTCCACGAATTTTGCCGATATGGAGCTGCTGAGCCACATACCATTG CTGCATTCTTGGGGGGAGCTGCTGCTCAAGAGGTCATCAAAATAATCACC AAACAATTTGTAATTTTTAATAATACTTACATTTACAGTGGCATGTCACA AACTTCAGCAACTTTCCAGTTGTAGAAGCTT
Amino Acid Sequence: 
Protein sequence of UBA3 MAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCK VLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIG RPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIA RRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACI ECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLD GDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIA AVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLP QNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSI EERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTSHHHHHH* Protein sequence of GST APPBP1 MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLVPRGSMAQLGKLLKEQKYDRQLRLWGDHG QEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNF FLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFT VVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIES HPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQ WYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNT ALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLP VRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPES ISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIV LYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMV KDDYVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSG MSQTSATFQL*
Price: £110.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
Thrombin
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Influenza: 
No
Ubiquitylation Site: 
Yes
Reagent Type: 

USP38 (1 - 1042)

Long Name: 
ubiquitin specific peptidase 38
Accession: 
NM_032557.6
Catalog Number (DU Number): 
DU35473
Protein Activity: 
Expression: 
Purification Method: 
GSH Agarose
Mono-Isotopic Mass: 
144, 257.22 daltons
Average Mass: 
144, 349.40 daltons
Theoretical PI: 
5.84
Purity: 
>85 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-70 deg C
Native Sequence: 
Amino acids M1 – F1042 (end) of human USP38. Residue M243 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 - 229
Cloning Sites: 
Not1 of pGex6P-2
Price: £110.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Tuesday, 10 May, 2022 - 15
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

RAD52 (1 - 418)

Long Name: 
RAD52 homolog, DNA repair protein
Accession: 
P43351-1
Catalog Number (DU Number): 
DU67602
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
72946.68 daltons
Average Mass: 
72992.82 daltons
Theoretical PI: 
6.99
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-70 deg C
Native Sequence: 
Amino acids M1 – S418 (end residue) of human RAD52. Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 - 228
Cloning Sites: 
BamH1 and Not1 sites of pGEX6P-1
Price: £110.00
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Tuesday, 1 March, 2022 - 11
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

UBE3C

DU Number: 
DU70989
Plasmid: 
pEBG6P UBE3C (with killed internal BamHI)
Expressed: 
GST 3C UBE3C
Genbank: 
NM_014671.2
Species: 
Human
Vector Type: 
Mammalian
Tag: 
Amino Acid Sequence: 
MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLVPRGSLEVLFQGPLGSMFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRRLKNAIIIQSFIRGYRDRK QQYSIQRSAFDRCATLSQSGGAFPIANGPNLTLLVRQLLFFYKQNEDSKRLIWLYQNLIKHSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCNDDSL NVALPMRMLEVFSSENTYLPVLQDASYVVSVIEQILHYMIHNGYYRSLYLLINSKLPSSIEYSDLSRVPIAKILLENVLKPLHFTYNSCPEGARQQVFTA FTEEFLAAPFTDQIFHFIIPALADAQTVFPYEPFLNALLLIESRCSRKSGGAPWLFYFVLTVGENYLGALSEEGLLVYLRVLQTFLSQLPVSPASASCHD SASDSEEESEEADKPSSPEDGRLSVSYITEECLKKLDTKQQTNTLLNLVWRDSASEEVFTTMASVCHTLMVQHRMMVPKVRLLYSLAFNARFLRHLWFLI SSMSTRMITGSMVPLLQVISRGSPMSFEDSSRIIPLFYLFSSLFSHSLISIHDNEFFGDPIEVVGQRQSSMMPFTLEELIMLSRCLRDACLGIIKLAYPE TKPEVREEYITAFQSIGVTTSSEMQQCIQMEQKRWIQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQ STLDVGLESPPLSVSEERQLAVLTELPFVVPFEERVKIFQRLIYADKQEVQGDGPFLDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLD EAGIDGGGIFREFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTSADVDIHHLASLD PEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEIQVL ISGAQVPISLEDLKSFTNYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPAFCIHNGGSDLERLPTASTCMNLLKLPEFYDE TLLRSKLLYAIECAAGFELS*
Price: £110.00
Completion Time: 
0
Wild-type or Mutant: 
New Protein: 
No
Low Temp: 
No
Hidden Project: 
No
Extra Protein: 
No
Cleavage Site: 
PreScission
Restricted Distribution: 
Not Restricted
COVID-19: 
No
Ubiquitylation Site: 
Yes
Reagent Type: 

WNK2 (1 - 627)

Catalog Number (DU Number): 
DU49486
Protein Activity: 
Expression: 
Purification Method: 
GSH Agarose
Price: £110.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Monday, 18 October, 2021 - 16
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

PLK4 (1 - 269)

Long Name: 
Polo Like Kinase 4
Accession: 
NM_014264.2
Catalog Number (DU Number): 
DU62994
Protein Activity: 
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
57, 562.27 daltons
Average Mass: 
57, 599.85 daltons
Theoretical PI: 
6.71
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-80 deg C
Assay Substrate: 
Myelin Basic Protein Final concentration: 1 mg/ml
Native Sequence: 
Amino acids M1 – S269 (end residue is H970) of human PLK4. Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 sites of pGEX6P-1
Target Family: 
Price: £110.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Tuesday, 21 November, 2017 - 11
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

PLK4 (1 - 970)

Long Name: 
Polo Like Kinase 4
Accession: 
NM_014264.2
Catalog Number (DU Number): 
DU43937
Protein Activity: 
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
135, 710.02 daltons
Average Mass: 
135, 796.11 daltons
Theoretical PI: 
8.35
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-80 deg C
Assay Substrate: 
Myelin Basic Protein Final concentration: 1 mg/ml
Native Sequence: 
Amino acids M1 – H970 (end residue) of human PLK4. Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 sites of pGEX6P-1
Target Family: 
Price: £110.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Tuesday, 21 November, 2017 - 11
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

PLK1 (37 - 338)

Long Name: 
Polo Like Kinase 1
Accession: 
NM_005030.6
Catalog Number (DU Number): 
DU61680
Protein Activity: 
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
61, 361.92 daltons
Average Mass: 
61, 401.41 daltons
Theoretical PI: 
8.54
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-80 deg C
Assay Substrate: 
ISDELMDATFADQEAKKK
Native Sequence: 
Amino acids P37 – N338 (end residue is S603) of human PLK1. Residue P232 of the fusion protein is equivalent to P37 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 sites of pGEX6P-1
Target Family: 
Price: £110.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Tuesday, 21 November, 2017 - 11
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

AAK1 (1 - 365)

Long Name: 
AP2 associated kinase 1
Accession: 
NM_014911.5
Catalog Number (DU Number): 
DU61573
Protein Activity: 
Expression: 
Purification Method: 
GSH-Agarose
Mono-Isotopic Mass: 
67, 338.03 daltons
Average Mass: 
67, 381.63 daltons
Theoretical PI: 
6.39
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature: 
-80 deg C
Assay Buffer: 
50 mM Tris-HCl pH 7.5, 0.1mM EGTA, 10 mM DTT, 10 mM MgAc
Assay Substrate: 
Myelin Basic Protein Final concentration: 1 mg/ml
Native Sequence: 
Amino acids M1 – A365 (end residue is L961) of human AAK1. Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 and Not1 sites of pFastBac-GST
Target Family: 
Price: £110.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Friday, 31 May, 2019 - 15
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

TYRO3 (468 - 890)

Long Name: 
TYRO3 protein tyrosine kinase
Accession: 
NM_006293.4
Catalog Number (DU Number): 
DU61217
Protein Activity: 
Expression: 
Purification Method: 
GSH Sepharose
Mono-Isotopic Mass: 
73, 802.14 daltons
Average Mass: 
73, 850.01 daltons
Theoretical PI: 
5.40
Purity: 
>80 %
Storage Buffer: 
50 mM Tris-HCl pH 7.5, 270 mM sucrose, 150 mM NaCl, 0.1 mM EGTA, 10 mM DTT, 0.02 % Brij-35, 0.2 mM PMSF, 1 mM Benzamidine.
Storage Temperature: 
-70 °C
Assay Buffer: 
50 mM Tris-HCl pH 7.5, 0.1mM EGTA, 10 mM DTT, 10 mM MgAc
Assay Substrate: 
Poly Glu Tyr (4:1) Final concentration: 0.1 mg/ml
Native Sequence: 
Amino acids M468 – C890 (end) of human TYRO3. Residue M232 of the fusion protein is equivalent to M468 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage: 
PreScission site (LEVLFQGP) residues 221 – 228
Cloning Sites: 
BamH1 and Not1 sites of pFastBac GST 6P1
Target Family: 
Price: £110.00
Type: 
Species: 
Tag: 
Terminus and Tag: 
N-Term
GST
Uncleaved
Uncleaved
Uncleaved
Extra Protein: 
No
Protein Complete: 
No
Protein Date Complete: 
Friday, 24 September, 2021 - 09
Auto Generated: 
No
Received Clone: 
No
LRRK2 ASAP: 
No
COVID-19: 
No
Ubiquitylation Site: 
No

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.