cDNA Clone - Rab8A

Name: Rab8A
Price per aliquot: £110.00
Expressed:
6His Rab8A S111TAG+ GRO EL/ES
Plasmid:
pNHD1.3 6HIS Rab8a S111TAG + Gro EL/ES
Parent Plasmid:
pNHD1.3 + Gro EL/ES
View Parent Plasmid

|
DU Number:
DU56041
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

Amino Acid Sequence:
View Sequence

MGHHHHHHMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITN EKSFDNIRNWIRNIEEHA*ADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKIT PDQQKRSSFFRCVLL*
Antibiotic:
Tetracycline
Low Growth Temperature Requirement?:
No

Do you need any help? Please get in touch and we’ll be happy to lend a hand.