cDNA Clone - Rab8A

Name: Rab8A
Price per aliquot: £110.00
Expressed:
6His Rab8A + GRO EL/ES
Plasmid:
pNHD1.3 6HIS Rab8a + Gro EL/ES
Parent Plasmid:
pNHD1.3 + Gro EL/ES
View Parent Plasmid

|
DU Number:
DU51338
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

TCTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATGTACATATGGGTCATCATCACCATCACCATATGGCGAAGACCTACGATTACCTGTTCAAGCTGC TGCTGATCGGGGACTCGGGGGTGGGGAAGACCTGTGTCCTGTTCCGCTTCTCCGAGGACGCCTTCAACTCCACTTTTATCTCCACCATAGGAATTGACTT TAAAATTAGGACCATAGAGCTCGATGGCAAGAGAATTAAACTGCAGATATGGGACACAGCCGGTCAGGAACGGTTTCGGACGATCACAACGGCCTACTAC AGGGGTGCAATGGGCATCATGCTGGTCTACGACATCACCAACGAGAAGTCCTTCGACAACATCCGGAACTGGATTCGCAACATTGAGGAGCACGCCTCTG CAGACGTCGAAAAGATGATACTCGGGAACAAGTGTGATGTGAATGACAAGAGACAAGTTTCCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAAT CAAGTTCATGGAGACCAGCGCGAAGGCCAACATCAATGTGGAAAATGCATTTTTCACTCTCGCCAGAGATATCAAAGCAAAAATGGACAAAAAATTGGAA GGCAACAGCCCCCAGGGGAGCAACCAGGGAGTCAAAATCACACCGGACCAGCAGAAGAGGAGCAGCTTTTTCCGATGTGTTCTTCTGTGAGGGGTACC
Amino Acid Sequence:
View Sequence

MGHHHHHHMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITN EKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKIT PDQQKRSSFFRCVLL*
Antibiotic:
Tetracycline
Comments:
subclone 6-His-Rab8a from plasmid DU51049 and insert into pNHD2 vector (using identical MCS as has been done for Rabs by Chin lab) and in addition subclone GroEL and GroES from plasmid DU51048 and insert into pNHD2 vector (in the same region as has been done by Chin lab). I have emailed you separately with info on Chin construct so that you know sites of insertion into pNHD2

Do you need any help? Please get in touch and we’ll be happy to lend a hand.