Substrate Peptides

Name Peptide Sequence Substrate For Derived from Price per aliquot (1mg) Add to cart
STK33 Substrate Peptide AALVRQMSVAFFFKKKKK STK33 - £20.00
CaMKK Substrate Peptide AKPKGNKDYHLQTCCGSLAYRRR CaMKK MELK-derived peptide £20.00
Sakamototide ALNRTSSDSALHRRR AMPK, SIK CRTC2 derived peptide £20.00
PIMtide ARKRRRHPSGPPTA PIM consensus peptide substrate £20.00
ABLtide EAIYAAPFAKKK ABL synthetic peptide substrate £20.00
Lyntide EFPIYDFLPAKKK Lyn, TEC - £20.00
Generic Protein Kinase Substrate ERMRPRKRQGSVRRRV Generic Substrate, PKC corresponds to pseudosubstrate region of the e-isotype of protein kinase C (PKCe) with an alanine to serine substitution £20.00
CDK7tide FLAKSFGSPNRAYKK CHK7, NEK6, NEK7 CDK7 derived peptide £20.00
HER2 Substrate Peptide GGMEDIYFEFMGGKKK HER2, cKIT, TIE2 identified by screening a degenerate peptide library £20.00
Crosstide GRPRTSSFAEG PKB, MSK, p70 S6K, SGK glycogen synthase kinase 3 (GSK3) derived peptide £20.00
SAMS peptide HMRSAMSGLHLVKRR AMPK acetyl-CoA carboxylase derived peptide £20.00
PLK Substrate Peptide ISDELMDATFADQEAKKK PLK1 - £20.00
WOODtide KKISGRLSPIMTEQ DYRK Forkhead derived peptide £20.00
IKK, TBK1 Substrate Peptide KKKERLLDDRHDSGLDSMKDEE IKK, TBK1 IkappaB alpha derived peptide £20.00
IGF1Rtide KKKSPGEYVNIEFG IGF1R, FGFR1 IRS-1 derived peptide £20.00
PRAKtide KKLNRTLSVA MAPKAP-K2, CaMK4, PKD1 Glycogen Synthase derived peptide £20.00
Generic Protein Kinase Substrate KKLSLQRSSSFKDFA Generic Substrate - £20.00
p70 S6 Kinase Substrate Peptide KKRNRTLTV p70 S6 kinase - £20.00
MLCK Substrate Peptide KKRPQRATSNVFA MLCK myosin regulatory light chain derived peptide £20.00
AXLtide KKSRGDYMTMQIG AXL, DDR2, INSRR Insulin receptor substrate 1 derived peptide £20.00
PhKtide KRKQISVRGL Phosphorylase Kinase glycogen phosphorylase derived peptide £20.00
CK1 Substrate Peptide KRRRALS(phospho)VASLPGL CK1 glycogen synthase derived peptide £20.00
PDKtide KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC PDK1, JAK2 residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984) £20.00
Tyrosine Kinase Peptide 1 KVEKIGEGTYGVVYK BRK, LCK, CSK, Src CDC2 derived peptide £20.00
IKK Substrate Peptide LDDRHDSGLDSMKDEEY IKK IkappaB alpha derived peptide £20.00
KEMPtide LRRASLG PKA - £20.00
Aurora Substrate Peptide LRRLSLGLRRLSLGLRRLSLGLRRLSLG Aurora - £20.00
Generic Protein Kinase Substrate LSNMNSDGEFLRTSCGSPNYRRR Generic Substrate - £20.00
Generic Protein Kinase Substrate RARTLSFAEPG Generic Substrate - £20.00
NEK2a Substrate Peptide RFRRSRRMI NEK2A - £20.00
EF2tide RKKFGESEKTKTKEFL EF2K dictyostelium myosin II heavy chain derived peptide £20.00
LRRKtide RLGRDKYKTLRQIRQ LRRK2, MAP4K3 Moesin derived peptide £20.00
CLK2 Substrate Peptide RNRYRDVSPFDHSR CLK2 - £20.00
GSK3 Substrate Peptide RRAAEELDSRAGS(phospho)PQL GSK3 eIF2B derived peptide £20.00
CK1 Substrate Peptide RRKDLHDDEEDEAMSITA CK1 synthetic peptide substrate £20.00
TGFBR1 Substrate Peptide RRKVLTQMGSPSIRCSS(phospho)VS TGFBR1 SMAD derived peptide £20.00
Tyrosine Kinase Peptide 3 RRLIEDAEYAARG Generic Substrate pp60Src derived peptide £20.00
CK2 Substrate Peptide RRRDDDSDDD CK2 consensus phosphorylation sequence for CK2 £20.00
PAKtide RRRLSFAEPG PAKs, Aurora - £20.00
PIM Substrate Peptide RSRHSSYPAGT PIM - £20.00
SRPKtide RSRSRSRSRSRSRSR SRPK ASF1/SF-2 derived peptide £20.00
CaMK1 substrate peptide YLRRRLSDSNF CaMK1 Synapsin 1 derived peptide £20.00
Glycogen Synthase Peptide 2 (Ala 21) YRRAAVPPSPSLSRHSSPHQAEDEEE GSK3 Negative Control Glycogen synthase derived peptide £20.00
Glycogen Synthase Peptide 2 YRRAAVPPSPSLSRHSSPHQS(phospho)EDEEE GSK3 Glycogen synthase derived peptide £20.00
CDK7 CDK9 Substrate Peptide YSPTSPSYSPTSPSYSPTSPSKKK CDK7, CDK9 RNA polymerase II CTD derived peptide £20.00
RAB8A phospho Thr 72 AGQERFRT(phospho)ITTAYYR PPM1H RAB8A residues 65 - 79 of human £20.00
RAB10 phospho Thr 73 AGQERFHT(phospho)ITTSYYR PPM1H RAB10 residues 66 - 80 of human £20.00

Do you need any help? Please get in touch and we’ll be happy to lend a hand.