Polyclonal Antibodies

Displaying 401 - 450 of 635 available to order
Type Gene Name/Antigen Name Text Full Name Immuno Sequence Sheep No Type Price per aliquot (100µg) Add to cart
Antibodies PPM1H View Data protein phosphatase, Mg2+/Mn2+ dependent 1H PPM1H (117 - 140) NSSKRRSSLPNGEGLQLKENSESE (residues 117 - 140) DA064 Polyclonal Antibody £110.00
Antibodies PPP4R2 View Data PPP4R2 phospho Thr 251 INGPGT*PRPLNR [residues 246 - 257 of human] S694C Polyclonal Antibody £110.00
Antibodies PPP4R3 View Data PPP4R3 phospho Ser 741 CLSGRQS*PSFK [residues 736 - 745 of human] S704C Polyclonal Antibody £110.00
Antibodies PRAK View Data p38-regulated/activated kinase PRAK phospho Thr 182 QGDLMT*PQFTP [residues 177 - 187 of human] S084A Polyclonal Antibody £110.00
Antibodies PRAS40 View Data 40 kDa proline-rich AKT substrate PRAS40 (238 - 256) DLPRPRLNTSDFQKLKRKY [residues 238 - 256 of human] S115B Polyclonal Antibody £110.00
Antibodies PRAS40 View Data 40 kDa proline-rich AKT substrate PRAS40 phospho Thr 246 CRPRLNT*SDFQK [residues 240 - 251 of human + N-terminal cysteine for coupling] S114B Polyclonal Antibody £110.00
Antibodies PROTOR View Data Protein observed with Rictor-1 PROTOR1 GST-PROTOR1 (1 - 388) [DU 10413] [Accession number NM_181333] - Originally named PRR5 S020C Polyclonal Antibody £110.00
Antibodies PTEN View Data PTEN phospho Thr 366 Phosphatase and tensin homolog TSVT*PDV [residues 363 - 369 of human] S663B Polyclonal Antibody £110.00
Antibodies PTEN View Data PTEN phospho Ser 370 Phosphatase and tensin homolog TPDVS*DNE [residues 366 - 373 of human] S570B Polyclonal Antibody £110.00
Antibodies RAB antibdies View Data RAB antibdies RAB antibdies Polyclonal Antibody £6,450.00
Antibodies RAB10 View Data RAB10 phospho Thr 73 AGQERFHT*ITTSYYR [residues 66 - 80 of human] S873D Polyclonal Antibody £110.00
Antibodies RAB10 View Data RAB10, member RAS oncogene family RAB10 (1 - 200) His-RAB10 (1 - 200) [DU 51004] SA146 Polyclonal Antibody £110.00
Antibodies RAB10 View Data RAB10, member RAS oncogene family RAB10 (131 - 155) CTPVKEPNSENVDISSGGGVTGWKSK [residues 131 - 155 of human] S945D Polyclonal Antibody £110.00
Antibodies RAB12 View Data RAB12 RAB12 [DU 52221] SA227 Polyclonal Antibody £110.00
Antibodies RAB12 View Data RAB12 phospho Ser 106 AGQERFNS*ITSAYYR [residues 99 - 113] S876D Polyclonal Antibody £110.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family Rab13 MBP-Rab13 [Du 43886] S806D Polyclonal Antibody £110.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family pseudogene Rab13 phospho Ser 111 KSIKENAS*AGVERLR [residues 104 - 117 of human] S505D Polyclonal Antibody £110.00
Antibodies RAB1A View Data RAB1A phospho Ser 114 CQEIDRYAS*ENVNKLR [residues 107 - 120 of human] S817D Polyclonal Antibody £110.00
Antibodies RAB1B View Data RAB1B phospho Ser 111 CQEIDRYAS*ENVNKLR [residues 104 - 118 of human] S817D Polyclonal Antibody £110.00
Antibodies Rab35 View Data RAB35 phospho Thr 72 AGQERFRT*ITSTYYR [residues 65 - 79 of human] SA083 Polyclonal Antibody £110.00
Antibodies RAB35 View Data RAB35 GST-RAB35 [DU 26867] SA314 Polyclonal Antibody £110.00
Antibodies RAB39B View Data RAB39B GST-RAB39B [DU 43849] S935D Polyclonal Antibody £110.00
Antibodies Rab3A View Data RAB3A phospho Thr 86 AGQERYRT*ITTAYYR [residues 79 - 93 of human] SA082 Polyclonal Antibody £110.00
Antibodies RAB43 View Data RAB43 GST-RAB43 [DU 50329] SA135 Polyclonal Antibody £110.00
Antibodies RAB43 View Data RAB43 phospho Thr 82 CAGQERFRT*ITQSYYR [residues 75 - 89 of human] SA334 Polyclonal Antibody £110.00
Antibodies RAB5A View Data RAB5A, member RAS oncogene family RAB5A phospho Ser 84 AGQERYHS*LAPMYYR [residues 77 - 91 of human] S942D Polyclonal Antibody £110.00
Antibodies Rab7A View Data RAB7A GST-RAB7A (mouse) [DU 46688] S824D Polyclonal Antibody £110.00
Antibodies RAB7A View Data RAB7A phospho Ser 72 AGQERFQS*LGVAFYR [residues 65 - 79 of human] S875D Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L phospho Thr 71 IAGQERFT*SMTRLYYR [residues 64 - 9 of human] S877D Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L (1 - 203) His-SUMO-RAB7L (1 - 203) [DU 50291] S984D Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L phospho Ser 72 DIAGQERFTS*MTRLYYRSS [residues 63 - 91 of human] SA136 Polyclonal Antibody £110.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A (172 - 203) CKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFR [residues 172 - 203 of human] S969D Polyclonal Antibody £110.00
Antibodies Rab8A View Data RAB8A, member RAS oncogene family Rab8A MBP-Rab8A [Du 16222] S804D Polyclonal Antibody £110.00
Antibodies Rab8a View Data RAB8A, member RAS oncogene family Rab8a phospho Ser 111 RNIEEHAS*ADVEKMR [residues 104 - 117 of human] S503D Polyclonal Antibody £110.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A phospho Thr 72 AGQERFRT*ITTAYYR [residues 65 - 79 of human] S874D Polyclonal Antibody £110.00
Antibodies Rab8B View Data RAB8B, member RAS oncogene family Rab8B MBP-Rab8B [Du 43885] S805D Polyclonal Antibody £110.00
Antibodies Rab8b View Data RAB8B, member RAS oncogene family Rab8b phospho Ser 111 RNIEEHAS*SDVERMR [residues 104 - 117 of human] S504D Polyclonal Antibody £110.00
Antibodies RanBP2 View Data RAN binding protein 2 GST-RanBP2 (2553 - 2838) GST-RanBP2 (2553 - 2838) [DU 41169] S363D Polyclonal Antibody £110.00
Antibodies RAP1GAP2 View Data RAP1 GTPase activating protein 2 RAP1GAP2 (260 - 480) GST-RAP1GAP2 (260 - 480) [DU 41252] S376D Polyclonal Antibody £110.00
Antibodies Raptor View Data Regulatory Associated Protein Of MTOR Raptor (1 - 20) MESEMLQSPLLGLGEEDEAD [residues 1 - 20 of human] S260D Polyclonal Antibody £110.00
Antibodies RASSF7 View Data Ras association domain family member 7 RASSF7 phospho Ser 111 CKKRCLIRAS*LPVKPR [residues 105 - 117 of human] SA360 Polyclonal Antibody £110.00
Antibodies REEP1 View Data Receptor Accessory Protein 1 GST-REEP1 (65 - end) GST-REEP1 (65 - end) [DU 31162] S280D Polyclonal Antibody £110.00
Antibodies REEP2 View Data Receptor Accessory Protein 2 GST-REEP2 (169 - end) GST-REEP2 (169 - end) [DU 40147] S301D Polyclonal Antibody £110.00
Antibodies REEP4 View Data Receptor Accessory Protein 4 GST-REEP4 (65 - end) GST-REEP4 (65 - end) [DU 36488] S281D Polyclonal Antibody £110.00
Antibodies REPS1 View Data RALBP1 Associated Eps Domain Containing 1 REPS1 phospho Ser 537 VTRQRSHS*GTSPDNT [residues 530 - 544 of human] S249D Polyclonal Antibody £110.00
Antibodies Ribosomal S6 protein View Data Ribosomal S6 protein Ribosomal S6 protein phospho Ser 235 AKRRRKS*SLRASTS [residues 229 - 242 of human] S441A Polyclonal Antibody £110.00
Antibodies Rictor View Data rapamycin-insensitive companion of mTOR Rictor (6 - 20) RGRSLKNLRVRGRND [residues 6 – 20 of human] S654B Polyclonal Antibody £110.00
Antibodies RNF12 View Data ring finger protein, LIM domain interacting RNF12 (1 - 271 mouse) GST-RNF12 (1 - 271 mouse) [DU 49042] S691D Polyclonal Antibody £110.00
Antibodies RNF12 View Data ring finger protein, LIM domain interacting RNF12 phospho Ser 212 Ser 214 QRRARS*RS*PEHRR [residues 207 - 219 of human] SA310 Polyclonal Antibody £110.00
Antibodies RNF12 View Data RNF12 (mouse) GST-RNF12 (mouse) [DU 49041] S708D Polyclonal Antibody £110.00


Do you need any help? Please get in touch and we’ll be happy to lend a hand.