cDNA Clone HiBiT

• Plasmid: pBabeD puro FLAG dTag Linker HiBiT
• Parent Plasmid: pBabeD puro FLAG
• Expressed: FLAG dTAG 5Gly HiBiT
• Genbank: -
• Tag: FLAG
• Species: Human

Amino Acid Sequence

MDYKDDDDKGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGII
PPHATLVFDVELLKLEGGGGGVSGWRLFKKIS*

• Vector Type: Mammalian
• Antibiotic: Amp
• Full Snapgene Map: pBabeD puro FLAG dTag Linker HiBiT400.3 KB Snapgene files can be opened using software available here: www.snapgene.com
• DU Number: DU61379
• Unit Source: Protein Phosphorylation and Ubiquitylation Unit
• Location: PPU
• MTA: Dundee
• Notes: Parent vector - DU61374 pBabeD puro FLAG BamH1 Linker HiBiT; NEB to add dTAG amplified from DU69382 using JC389/JC390
• Low Temp: No