Recombinant Protein - JAK2 (809 - 1132)

Name: JAK2 (809 - 1132)
Price per aliquot (100µg): £110.00
Long Name:
Janus Kinase 2
Synonyms:
Janus Kinase 2
Catalog Number (DU Number):
DU 19349
Accession:
NP_004963.1
Expression:
baculovirus
Tag and Terminus:
N-Term
GST
Uncleaved

C-Term
6His
Uncleaved
Purification Method:
GSH Sepharose
Enzymatic Buffer:
50 mM Tris-HCl pH 7.5, 0.1mM EGTA, 10 mM DTT, 10 mM MgAc, 5 mM MnCl2
Enzymatic Substrate:
PDKtide [[protein fragment, 39 aa]] Final concentration: 100 μM
Calculated molecular mass:
Mono-Isotopic Mass: 65, 980.27 daltons
Average Mass: 66, 022.90 daltons
Protein Activity:
Constitutively Active
Purity:
>80 %
Storage Buffer:
50 mM Tris-HCl pH 7.5, 270 mM sucrose, 150 mM NaCl, 0.1 mM EGTA, 10 mM DTT, 0.02 % Brij-35, 0.2 mM PMSF, 1 mM Benzamidine.
Storage Temperature:
-70 °C
Theoretical PI:
6.09
Gel Information :
  • Gel Image 1: 
Native Sequence:
Amino acids F808 – G1132 (end) of human JAK2. Residue F236 of fusion protein is equilivalent to F808 of the native enzyme. The GST tag is located at residues 1 – 220 and the His(6) tag is located at residues 560 – 565.
Protease Cleavage:
PreScission (LEVLFQGP) residues 221 - 228
Cloning Sites:
EcoR1 and Not1 of pFastBac GST 6P

Do you need any help? Please get in touch and we’ll be happy to lend a hand.