cDNA Clone - USP45

Name: USP45
Price per aliquot: £110.00
Expressed:
FLAG-USP45 E26A
Plasmid:
pCMV5D FLAG USP45 E26A
Parent Plasmid:
pCMV5D FLAG
View Parent Plasmid

Snapgene File | Genbank File
gacggatcgggagatctcccgatcccctatggtgcactctcagtacaatctgctctgatgccgcatagttaagccagtatctgctccctgcttgtgtgttggaggtcgctgagtagtgcgcgagcaaaatttaagctacaacaaggcaaggcttgaccgacaattgcatgaagaatctgcttagggttaggcgttttgcgctgcttcgcgatgtacgggccagatatacgcgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacaccaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccgtcagaattggccaccggatctgccgccatggactacaaggacgatgacgataagggatccttcgaagaattcgctagcctcgagaagcttgcggccgcttacccatacgatgtgccagattacgcctaagtcgagtctagagggcccgtttaaacccgctgatcagcctcgactgtgccttctagttgccagccatctgttgtttgcccctcccccgtgccttccttgaccctggaaggtgccactcccactgtcctttcctaataaaatgaggaaattgcatcgcattgtctgagtaggtgtcattctattctggggggtggggtggggcaggacagcaagggggaggattgggaagacaatagcaggcatgctggggatgcggtgggctctatggcttctgaggcggaaagaaccagctggggctctagggggtatccccacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcgggggctccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtacctagaagttcctattccgaagttcctattctctagaaagtataggaacttccttggccaaaaagcctgaactcaccgcgacgtctgtcgagaagtttctgatcgaaaagttcgacagcgtctccgacctgatgcagctctcggagggcgaagaatctcgtgctttcagcttcgatgtaggagggcgtggatatgtcctgcgggtaaatagctgcgccgatggtttctacaaagatcgttatgtttatcggcactttgcatcggccgcgctcccgattccggaagtgcttgacattggggagttcagcgagagcctgacctattgcatctcccgccgtgcacagggtgtcacgttgcaagacctgcctgaaaccgaactgcccgctgttctgcagccggtcgcggaggccatggatgcgatcgctgcggccgatcttagccagacgagcgggttcggcccattcggaccgcaaggaatcggtcaatacactacatggcgtgatttcatatgcgcgattgctgatccccatgtgtatcactggcaaactgtgatggacgacaccgtcagtgcgtccgtcgcgcaggctctcgatgagctgatgctttgggccgaggactgccccgaagtccggcacctcgtgcacgcggatttcggctccaacaatgtcctgacggacaatggccgcataacagcggtcattgactggagcgaggcgatgttcggggattcccaatacgaggtcgccaacatcttcttctggaggccgtggttggcttgtatggagcagcagacgcgctacttcgagcggaggcatccggagcttgcaggatcgccgcggctccgggcgtatatgctccgcattggtcttgaccaactctatcagagcttggttgacggcaatttcgatgatgcagcttgggcgcagggtcgatgcgacgcaatcgtccgatccggagccgggactgtcgggcgtacacaaatcgcccgcagaagcgcggccgtctggaccgatggctgtgtagaagtactcgccgatagtggaaaccgacgccccagcactcgtccgagggcaaaggaatagcacgtactacgagatttcgattccaccgccgccttctatgaaaggttgggcttcggaatcgttttccgggacgccggctggatgatcctccagcgcggggatctcatgctggagttcttcgcccaccccaacttgtttattgcagcttataatggttacaaataaagcaatagcatcacaaatttcacaaataaagcatttttttcactgcattctagttgtggtttgtccaaactcatcaatgtatcttatcatgtctgtataccgtcgacctctagctagagcttggcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgtc
DU Number:
DU48316
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

AGATCTATGCGGGTGAAAGATCCAACTAAAGCTTTACCTGAGAAAGCCAAAAGAAGTAAAAGGCCTACTGTACCTCATGATGCAGACTCTTCAGATGATATTGCTGTAGGTTTAACTTGCCAACATGTAAGTCATGCTATCAGCGTGAATCATGTAAAGAGAGCAATAGCTGAGAATCTGTGGTCAGTTTGCTCAGAATGTTTAAAAGAAAGAAGATTCTATGATGGGCAGCTAGTACTTACTTCTGATATTTGGTTGTGCCTCAAGTGTGGCTTCCAGGGATGTGGTAAAAACTCAGAAAGCCAACATTCATTGAAGCACTTTAAGAGTTCCAGAACAGAGCCCCATTGTATTATAATTAATCTGAGCACATGGATTATATGGTGTTATGAATGTGATGAAAAATTATCAACGCATTGTAATAAGAAGGTTTTGGCTCAGATAGTTGATTTTCTCCAGAAACATGCTTCTAAAACACAAACAAGTGCATTTTCTAGAATCATGAAACTTTGTGAAGAAAAATGTGAAACAGATGAAATACAGAAGGGAGGAAAATGCAGAAATTTATCTGTAAGAGGAATTACAAATTTAGGAAATACTTGCTTTTTTAATGCAGTCATGCAGAACTTGGCACAGACTTATACTCTTACTGATCTGATGAATGAGATCAAAGAAAGTAGTACAAAACTCAAGATTTTTCCTTCCTCAGACTCTCAGCTGGACCCATTGGTGGTGGAACTTTCAAGGCCTGGACCACTGACTTCTGCCTTGTTCCTGTTTCTTCACAGCATGAAGGAGACTGAAAAAGGACCACTTTCTCCTAAAGTTCTTTTTAATCAGCTTTGTCAGAAGGCACCTCGATTTAAAGATTTCCAGCAACAGGACAGTCAGGAGCTTCTTCATTATCTTCTGGATGCAGTGAGGACAGAAGAAACAAAGCGAATACAAGCTAGCATTCTAAAAGCATTTAACAACCCAACTACTAAAACTGCTGATGATGAAACTAGAAAAAAAGTCAAAGCATATGGAAAAGAAGGTGTGAAAATGAACTTCATAGATCGGATCTTTATTGGTGAATTAACTAGCACGGTCATGTGTGAAGAATGTGCAAATATCTCCACGGTGAAAGATCCATTCATTGATATTTCACTTCCTATAATAGAAGAAAGGGTTTCAAAACCTTTACTTTGGGGAAGAATGAATAAATATAGAAGTTTACGGGAGACAGATCATGATCGATACAGTGGCAATGTTACTATAGAAAATATTCATCAACCTAGAGCTGCCAAGAAGCATTCTTCATCTAAAGATAAGAGTCAACTAATTCATGACCGAAAATGTATTAGAAAATTGTCATCTGGAGAAACTGTCACATACCAGAAAAATGAAAACCTTGAAATGAATGGGGATTCTTTAATGTTTGCCAGCCTCATGAATTCTGAGTCACGTCTGAATGAAAGCCCTACTGATGACAGTGAAAAAGAAGCCAGCCATTCTGAAAGCAATGTTGATGCTGACAGTGAGCCTTCAGAATCTGAAAGTGCTTCAAAGCAGACTGGGCTGTTCAGATCCAGTAGTGGATCCGGTGTGCAGCCAGATGGACCCCTTTACCCTCTGTCAGCAGGTAAACTGCTGTACACCAAGGAGACTGACAGTGGTGATAAGGAAATGGCAGAAGCTATTTCTGAACTTCGTTTGAGCAGCACTGTAACTGGAGATCAAGATTTTGACAGAGAAAATCAGCCACTAAATATTTCAAATAATTTATGTTTTTTGGAGGGGAAGCATTTGAGGTCTTATAGTCCCCAAAATGCTTTTCAGACCCTTTCTCAGAGCTATATAACTACTTCTAAAGAATGTTCAATTCAGTCCTGTCTCTACCAGTTTACATCTATGGAATTACTAATGGGGAATAATAAGCTTCTATGTGAGAATTGTACTAAAAACAAACAGAAGTACCAAGAAGAAACCAGTTTTGCAGAAAAGAAAGTAGAAGGAGTTTATACTAATGCCAGGAAGCAATTGCTCATTTCTGCTGTTCCAGCTGTCCTAATTCTCCACCTGAAAAGATTTCATCAGGCTGGCTTGAGTCTTCGTAAAGTAAACAGACATGTAGATTTTCCACTTATGCTCGATTTAGCACCATTCTGCTCTGCTACTTGTAAGAATGCAAGTGTGGGAGATAAAGTTCTCTACGGTCTCTATGGCATAGTGGAACATAGTGGCTCGATGAGAGAAGGCCACTACACTGCTTATGTGAAAGTGAGAACACCCTCCAGGAAATTATCGGAACATAACACTAAAAAGAAAAATGTGCCTGGTTTGAAAGCGGCTGATAATGAATCAGCAGGCCAGTGGGTCCATGTTAGTGACACTTACTTACAGGTGGTTCCAGAATCAAGAGCACTTAGTGCACAAGCCTACCTTCTTTTCTATGAAAGAGTATTATAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MDYKDDDDKGSMRVKDPTKALPEKAKRSKRPTVPHDADSSDDIAVGLTCQ HVSHAISVNHVKRAIAENLWSVCSECLKERRFYDGQLVLTSDIWLCLKCG FQGCGKNSESQHSLKHFKSSRTEPHCIIINLSTWIIWCYECDEKLSTHCN KKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQKGGKCRNLSV RGITNLGNTCFFNAVMQNLAQTYTLTDLMNEIKESSTKLKIFPSSDSQLD PLVVELSRPGPLTSALFLFLHSMKETEKGPLSPKVLFNQLCQKAPRFKDF QQQDSQELLHYLLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKA YGKEGVKMNFIDRIFIGELTSTVMCEECANISTVKDPFIDISLPIIEERV SKPLLWGRMNKYRSLRETDHDRYSGNVTIENIHQPRAAKKHSSSKDKSQL IHDRKCIRKLSSGETVTYQKNENLEMNGDSLMFASLMNSESRLNESPTDD SEKEASHSESNVDADSEPSESESASKQTGLFRSSSGSGVQPDGPLYPLSA GKLLYTKETDSGDKEMAEAISELRLSSTVTGDQDFDRENQPLNISNNLCF LEGKHLRSYSPQNAFQTLSQSYITTSKECSIQSCLYQFTSMELLMGNNKL LCENCTKNKQKYQEETSFAEKKVEGVYTNARKQLLISAVPAVLILHLKRF HQAGLSLRKVNRHVDFPLMLDLAPFCSATCKNASVGDKVLYGLYGIVEHS GSMREGHYTAYVKVRTPSRKLSEHNTKKKNVPGLKAADNESAGQWVHVSD TYLQVVPESRALSAQAYLLFYERVL*
Antibiotic:
Amp
Comments:
E26A, also contains two silent nucleotide changes as compared to the reference seq; C>T 756 and A>T 759 bp.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.