cDNA Clone - 53BP1

Name: 53BP1
Price per aliquot: £110.00
Expressed:
HA-53BP1
Plasmid:
pRS416 HA.53BP1
Parent Plasmid:
pRS416
View Parent Plasmid

Snapgene File | Genbank File
TCGCGCGTTTCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACGGTCACAGCTTGTCTGTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGGCGCGTCAGCGGGTGTTGGCGGGTGTCGGGGCTGGCTTAACTATGCGGCATCAGAGCAGATTGTACTGAGAGTGCACCATACCACAGCTTTTCAATTCAATTCATCATTTTTTTTTTATTCTTTTTTTTGATTTCGGTTTCTTTGAAATTTTTTTGATTCGGTAATCTCCGAACAGAAGGAAGAACGAAGGAAGGAGCACAGACTTAGATTGGTATATATACGCATATGTAGTGTTGAAGAAACATGAAATTGCCCAGTATTCTTAACCCAACTGCACAGAACAAAAACCTGCAGGAAACGAAGATAAATCATGTCGAAAGCTACATATAAGGAACGTGCTGCTACTCATCCTAGTCCTGTTGCTGCCAAGCTATTTAATATCATGCACGAAAAGCAAACAAACTTGTGTGCTTCATTGGATGTTCGTACCACCAAGGAATTACTGGAGTTAGTTGAAGCATTAGGTCCCAAAATTTGTTTACTAAAAACACATGTGGATATCTTGACTGATTTTTCCATGGAGGGCACAGTTAAGCCGCTAAAGGCATTATCCGCCAAGTACAATTTTTTACTCTTCGAAGACAGAAAATTTGCTGACATTGGTAATACAGTCAAATTGCAGTACTCTGCGGGTGTATACAGAATAGCAGAATGGGCAGACATTACGAATGCACACGGTGTGGTGGGCCCAGGTATTGTTAGCGGTTTGAAGCAGGCGGCAGAAGAAGTAACAAAGGAACCTAGAGGCCTTTTGATGTTAGCAGAATTGTCATGCAAGGGCTCCCTATCTACTGGAGAATATACTAAGGGTACTGTTGACATTGCGAAGAGCGACAAAGATTTTGTTATCGGCTTTATTGCTCAAAGAGACATGGGTGGAAGAGATGAAGGTTACGATTGGTTGATTATGACACCCGGTGTGGGTTTAGATGACAAGGGAGACGCATTGGGTCAACAGTATAGAACCGTGGATGATGTGGTCTCTACAGGATCTGACATTATTATTGTTGGAAGAGGACTATTTGCAAAGGGAAGGGATGCTAAGGTAGAGGGTGAACGTTACAGAAAAGCAGGCTGGGAAGCATATTTGAGAAGATGCGGCCAGCAAAACTAAAAAACTGTATTATAAGTAAATGCATGTATACTAAACTCACAAATTAGAGCTTCAATTTAATTATATCAGTTATTACCCTATGCGGTGTGAAATACCGCACAGATGCGTAAGGAGAAAATACCGCATCAGGAAATTGTAAACGTTAATATTTTGTTAAAATTCGCGTTAAATTTTTGTTAAATCAGCTCATTTTTTAACCAATAGGCCGAAATCGGCAAAATCCCTTATAAATCAAAAGAATAGACCGAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTAAAGAACGTGGACTCCAACGTCAAAGGGCGAAAAACCGTCTATCAGGGCGATGGCCCACTACGTGAACCATCACCCTAATCAAGTTTTTTGGGGTCGAGGTGCCGTAAAGCACTAAATCGGAACCCTAAAGGGAGCCCCCGATTTAGAGCTTGACGGGGAAAGCCGGCGAACGTGGCGAGAAAGGAAGGGAAGAAAGCGAAAGGAGCGGGCGCTAGGGCGCTGGCAAGTGTAGCGGTCACGCTGCGCGTAACCACCACACCCGCCGCGCTTAATGCGCCGCTACAGGGCGCGTCGCGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGTTGTAAAACGACGGCCAGTGAGCGCGCGTAATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCCCCCTCGAGGTCGACGGTATCGATAAGCTTGATATCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGGAGCTCCAGCTTTTGTTCCCTTTAGTGAGGGTTAATTGCGCGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATAGGAGCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCCTAATGAGTGAGGTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGGACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTGGGTCCTTTTCATCACGTGCTATAAAAATAATTATAATTTAAATTTTTTAATATAAATATATAAATTAAAAATAGAAAGTAAAAAAAGAAATTAAAGAAAAAATAGTTTTTGTTTTCCGAAGATGTAAAAGACTCTAGGGGGATCGCCAACAAATACTACCTTTTATCTTGCTCTTCCTGCTCTCAGGTATTAATGCCGAATTGTTTCATCTTGTCTGTGTAGAAGACCACACACGAAAATCCTGTGATTTTACATTTTACTTATCGTTAATCGAATGTATATCTATTTAATCTGCTTTTCTTGTCTAATAAATATATATGTAAAGTACGCTTTTTGTTGAAATTTTTTAAACCTTTGTTTATTTTTTTTTCTTCATTCCGTAACTCTTCTACCTTCTTTATTTACTTTCTAAAATCCAAATACAAAACATAAAAATAAATAAACACAGAGTAAATTCCCAAATTATTCCATCATTAAAAGATACGAGGCGCGTGTAAGTTACAGGCAAGCGATCCGTCCTAAGAAACCATTATTATCATGACATTAACCTATAAAAATAGGCGTATCACGAGGCCCTTTCGTC
DU Number:
DU5509
Genbank:
Species:
Human
Synonyms:
TP53BP1
Sequence of Insert:
View Sequence

ggtaccGCCACCATGTACCCATACGATGTGCCAGATTACGCCATGGACCC TACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCC TGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTCT GGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCA CAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTG GAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAA AACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTC CATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTG TTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGA GAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAA TACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTT TTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGTG CCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGG TTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAG AACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATC CCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAA TCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTG TTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAA AGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCA GGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCT CTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCC ACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGA CAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTT TCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGG AGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGA GCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACC CCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATA TCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCA GCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAAC AATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGACA GTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGA TCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAA GTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATT GATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCC AGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGA ATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACA AAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGG TTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCA CTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGAG GCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACA CCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGA CACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGT GTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCT TCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAA CCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAA GAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGA CTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATG TTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCA TGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGA CACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGA CTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCT TTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCC CCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGG CTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAG CCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCC ATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTG GTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGAGACAC AGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAG TGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGA GTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGT CTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTT GCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTA CTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTG AGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCC CCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAG GAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGCAGAGT CAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGC TTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAA TGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAG GAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGG AATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAG CAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGAC CAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGG TGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCC AGGGAGAAGAAGAGTTTGATATGCCTCAGCCTCCACATGGCCATGTCTTA CATCGTCACATGAGAACAATCCGGGAAGTACGCACACTTGTCACTCGTGT CATTACAGATGTGTATTATGTGGATGGAACAGAAGTAGAAAGAAAAGTAA CTGAGGAGACTGAAGAGCCAATTGTAGAGTGTCAGGAGTGTGAAACTGAA GTTTCCCCTTCACAGACTGGGGGCTCCTCAGGTGACCTGGGGGATATCAG CTCCTTCTCCTCCAAGGCATCCAGCTTACACCGCACATCAAGTGGGACAA GTCTCTCAGCTATGCACAGCAGTGGAAGCTCAGGGAAAGGAGCCGGACCA CTCAGAGGGAAAACCAGCGGGACAGAACCCGCAGATTTTGCCTTACCCAG CTCCCGAGGAGGCCCAGGAAAACTGAGTCCTAGAAAAGGGGTCAGTCAGA CAGGGACGCCAGTGTGTGAGGAGGATGGTGATGCAGGCCTTGGCATCAGA CAGGGAGGGAAGGCTCCAGTCACGCCTCGTGGGCGTGGGCGAAGGGGCCG CCCACCTTCTCGGACCACTGGAACCAGAGAAACAGCTGTGCCTGGCCCCT TGGGCATAGAGGACATTTCACCTAACTTGTCACCAGATGATAAATCCTTC AGCCGTGTCGTGCCCCGAGTGCCAGACTCCACCAGACGAACAGATGTGGG TGCTGGTGCTTTGCGTCGTAGTGACTCTCCAGAAATTCCTTTCCAGGCTG CTGCTGGCCCTTCTGATGGCTTAGATGCCTCCTCTCCAGGAAATAGCTTT GTAGGGCTCCGTGTTGTAGCCAAGTGGTCATCCAATGGCTACTTTTACTC TGGGAAAATCACACGAGATGTCGGAGCTGGGAAGTATAAATTGCTCTTTG ATGATGGGTACGAATGTGATGTGTTGGGCAAAGACATTCTGTTATGTGAC CCCATCCCGCTGGACACTGAAGTGACGGCCCTCTCGGAGGATGAGTATTT CAGTGCAGGAGTGGTGAAAGGACATAGGAAGGAGTCTGGGGAACTGTACT ACAGCATTGAAAAAGAAGGCCAAAGAAAGTGGTATAAGCGAATGGCTGTC ATCCTGTCCTTGGAGCAAGGAAACAGACTGAGAGAGCAGTATGGGCTTGG CCCCTATGAAGCAGTAACACCTCTTACAAAGGCAGCAGATATCAGCTTAG ACAATTTGGTGGAAGGGAAGCGGAAACGGCGCAGTAACGTCAGCTCCCCA GCCACCCCTACTGCCTCCAGTAGCAGCAGCACAACCCCTACCCGAAAGAT CACAGAAAGTCCTCGTGCCTCCATGGGAGTTCTCTCAGGCAAAAGAAAAC TTATCACTTCTGAAGAGGAACGGTCCCCTGCCAAGCGAGGTCGCAAGTCT GCCACAGTAAAACCTGGTGCAGTAGGGGCAGGAGAGTTTGTGAGCCCCTG TGAGAGTGGAGACAACACCGGTGAACCCTCTGCCCTGGAAGAGCAGAGAG GGCCTTTGCCTCTCAACAAGACCTTGTTTCTGGGCTACGCATTTCTCCTT ACCATGGCCACAACCAGTGACAAGTTGGCCAGCCGCTCCAAACTGCCAGA TGGTCCTACAGGAAGCAGTGAAGAAGAGGAGGAATTTTTGGAAATTCCTC CTTTCAACAAGCAGTATACAGAATCCCAGCTTCGAGCAGGAGCTGGCTAT ATCCTTGAAGATTTCAATGAAGCCCAGTGTAACACAGCTTACCAGTGTCT TCTAATTGCGGATCAGCATTGTCGAACCCGGAAGTACTTCCTGTGCCTTG CCAGTGGGATTCCTTGTGTGTCTCATGTCTGGGTCCATGATAGTTGCCAT GCCAACCAGCTCCAGAACTACCGTAATTATCTGTTGCCAGCTGGGTACAG CCTTGAGGAGCAAAGAATTCTGGACTGGCAACCCCGTGAAAATCCTTTCC AGAATCTGAAGGTACTCTTGGTATCAGACCAACAGCAGAACTTCCTGGAG CTCTGGTCTGAGATCCTCATGACTGGTGGTGCAGCCTCTGTGAAGCAGCA CCATTCAAGTGCCCATAACAAAGATATTGCTTTAGGGGTATTTGATGTGG TGGTGACGGACCCCTCATGCCCAGCCTCGGTGCTGAAGTGTGCTGAAGCA TTGCAGCTGCCTGTGGTGTCACAAGAGTGGGTGATCCAGTGCCTCATTGT TGGGGAGAGAATTGGATTCAAGCAGCATCCAAAATATAAACACGATTATG TTTCTCACTAAggtacc
Amino Acid Sequence:
View Sequence

MYPYDVPDYAMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHF SMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVA DPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELE QKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQDVEENTVPYEV DKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTA QPSKDVHVVKEQNPPPARSEDMPFSPKASVAAMEAKEQLSAQELMESGLQ IQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLH LLQLSGQRSLVQDSLSTNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDK PMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQST PVFPPGSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECS KTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDG ENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDD TDTRDDISILATGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEALSS VLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLH LSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLAILDQELEH KEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDI APEIEPCAENRLDTKEEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRA DDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAH ASQSFCESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPI GISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCLRMK LVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCIC EARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGDHTIRQSQQPM KPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPS KALIERPSQNNIGIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQNFG KQDATVQTERGSGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRHM RTIREVRTLVTRVITDVYYVDGTEVERKVTEETEEPIVECQECETEVSPS QTGGSSGDLGDISSFSSKASSLHRTSSGTSLSAMHSSGSSGKGAGPLRGK TSGTEPADFALPSSRGGPGKLSPRKGVSQTGTPVCEEDGDAGLGIRQGGK APVTPRGRGRRGRPPSRTTGTRETAVPGPLGIEDISPNLSPDDKSFSRVV PRVPDSTRRTDVGAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLR VVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPL DTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSL EQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSNVSSPATPT ASSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPAKRGRKSATVK PGAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMAT TSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILED FNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQL QNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSE ILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLP VVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH*
Antibiotic:
Amp
Comments:
Yeast expression construct for expression of 53BP1 with N-terminal HA tag.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.