cDNA Clone - ABIN1

Name: ABIN1
Price per aliquot: £110.00
Expressed:
FLAG ABIN1 delta 410-428
Plasmid:
pCMV-FLAG-1 ABIN1 delta 410-428
Parent Plasmid:
pCMV5 FLAG1
View Parent Plasmid

Snapgene File | Genbank File
cccattcgccattcaggctgcgcaactgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggcgaaagggggatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacgacggccagtgccaagctgatctatacattgaatcaatattggcaattagccatattagtcattggttatatagcataaatcaatattggctattggccattgcatacgttgtatctatatcataatatgtacatttatattggctcatgtccaatatgaccgccatgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacaccaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccgtcaGAATTGGCCACCATGgactacaaggacgatgacgataagGGATCCCCGGAATTCCCGGGTCGACTCGAGCGGCCGCGGATCTcgggtggcatccctgtgacccctccccagtgcctctcctggccctggaagttgccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtccttctataatattatggggtggaggggggtggtatggagcaaggggcaagttgggaagacaacctgtagggcctgcggggtctattgggaaccaagctggagtgcagtggcacaatcttggctcactgcaatctccgcctcctgggttcaagcgattctcctgcctcagcctcccgagttgttgggattccaggcatgcatgaccaggctcagctaatttttgtttttttggtagagacggggtttcaccatattggccaggctggtctccaactcctaatctcaggtgatctacccaccttggcctcccaaattgctgggattacaggcgtgaaccactgctcccttccctgtccttctgattttaaaataactataccagcaggaggacgtccagacacagcataggctacctgccatggcccaaccggtgggacatttgagttgcttgcttggcactgtcctctcatgcgttgggtccactcagtagatgcctgttgaattgggtacgcggccagcttctgtggaatgtgtgtcagttagggtgtggaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccaggtgtggaaaagtccccaggctccccagcaggcagaagtatgcaaagcatgcatctcaattagtcagcaaccatagtcccgcccctaactccgcccatcccgcccctaactccgcccagttccgcccattctccgccccatggctgactaattttttttatttatgcagaggccgaggccgcctcggcctctgagctattccagaagtagtgaggaggcttttttggaggcctaggcttttgcaaaaagctcctcgaggaactgaaaaaccagaaagttaattccctatagtgagtcgtattaaattcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaaggacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcggggcatccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtagtgggccatcgccctgatagacggtttttcgccctttgacgttggagtccacgttctttaatagtggactcttgttccaaactggaacaacactcaaccctatctcggtctattcttttgatttataagggattttgccgatttcggcctattggttaaaaaatgagctgatttaacaaaaatttaacgcgaattttaacaaaatattaacaaaatattaacgtttacaatttc
DU Number:
DU35762
Genbank:
Species:
Human
Synonyms:
TNIP1
Sequence of Insert:
View Sequence

GGATCCATGGAAGGGAGAGGACCGTACCGGATCTACGACCCTGGGGGCAG CGTGCCCTCAGGAGAGGCATCCGCAGCTTTTGAGCGCCTAGTGAAGGAGA ATTCCCGGCTGAAGGAAAAAATGCAAGGGATAAAGATGTTAGGGGAGCTT TTGGAAGAGTCCCAGATGGAAGCGACCAGGCTCCGGCAGAAGGCAGAGGA GCTAGTGAAGGACAACGAGCTGCTCCCACCACCTTCTCCCTCCTTGGGCT CCTTCGACCCCCTGGCTGAGCTCACAGGAAAGGACTCAAATGTCACAGCA TCTCCCACAGCCCCTGCATGCCCCAGTGACAAGCCAGCACCAGTCCAGAA GCCTCCATCCAGTGGCACCTCCTCTGAATTTGAAGTGGTCACTCCTGAGG AGCAGAATTCACCAGAGAGCAGCAGCCATGCCAATGCGATGGCGCTGGGC CCCCTGCCCCGTGAGGACGGCAACCTGATGCTGCACCTGCAGCGCCTGGA GACCACGCTGAGTGTGTGTGCCGAGGAGCCGGACCACGGCCAGCTCTTCA CCCACCTGGGCCGCATGGCCCTGGAGTTCAACCGACTGGCATCCAAGGTG CACAAGAATGAGCAGCGCACCTCCATTCTGCAGACCCTGTGTGAGCAGCT TCGGAAGGAGAACGAGGCTCTGAAGGCCAAGTTGGATAAGGGCCTGGAAC AGCGGGATCAGGCTGCCGAGAGGCTGCGGGAGGAAAATTTGGAGCTCAAG AAGTTGTTGATGAGCAATGGCAACAAAGAGGGTGCGTCTGGGCGGCCAGG CTCACCGAAGATGGAAGGGACAGGCAAGAAGGCAGTGGCTGGACAGCAGC AGGCTAGTGTGACGGCAGGTAAGGTCCCAGAGGTGGTGGCCTTGGGCGCA CCCGAGAAGAAGGTGAAGATGCTGGAGCAGCAGCGCAGTGAGCTGCTGGA AGTGAACAAGCAGTGGGACCAGCATTTCCGGTCCATGAAGCAGCAGTATG AGCAGAAGATCACTGAGCTGCGTCAGAAGCTGGCTGATTTGCAGAAGCAG GTGACTGACCTGGAGGCCGAGCGGGAGCAGAAGCAGCGTGACTTTGACCG CAAGCTCCTCCTGGCCAAGTCCAAGATTGAAATGGAGGAGACCGACAAGG AGCAGCTGACAGCAGAGGCCAAGGAGCTGCGCCAAAAGGTCAAGTACCTG CAGGATCAGCTGAGCCCACTCACCCGACAGCGTATCCAAACCCCGCCATC ATCTCCACCAACAGCATTTGGGAGCCCAGAAGGAGCAGGGGCCCTCCTAA GGAAACAGGAGCTGGTCACGCAGAATGAGTTGCTGAAACAGCAGGTGAAG ATCTTCGAGGAGGACTTCCAGAGGGAGCGCAGTGATCGTGAGCGCATGAA TGAGGAGAAGGAAGAGCTGAAGAAGCAAGTGGAGAAGCTGCAGGCCCAGG TCACCCTGTCAAATGCCCAGCTAAAAGCATTCAAAGATGAGGAGAAGGCA AGAGAAGCCCTCAGACAGCAGAAGAGGAAAGCAAAGGCCTCAGGAGAGCG TTACCATGTGGAGCCCCACCCAGAACATCTCTGCGGGGCCTACCCCTACG CCTACCCGCCCATGCCAGCCATGGTGCCACACCATGGCTTCGAGGACTGG TCCCAGATCCGCTACCCCCCTCCCCCCATGGCCATGGAGCACCCGCCCCC ACTCCCCAACTCGCGCCTCTTCCATCTGCCGGAATACACCTGGCGTCTAC CTTGTGGAGGGGTTCGAAATCCAAATCAGAGCTCCCAAGTGATGGACCCT CCCACAGCCAGGCCTACAGAACCAGAGTCTCCAAAAAATGACCGTGAGGG GCCTCAGTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MDYKDDDDKGSMEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKM QGIKMLGELLEESQMEATRLRQKAEELVKDNELLPPPSPSLGSFDPLAEL TGKDSNVTASPTAPACPSDKPAPVQKPPSSGTSSEFEVVTPEEQNSPESS SHANAMALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQLFTHLGRMAL EFNRLASKVHKNEQRTSILQTLCEQLRKENEALKAKLDKGLEQRDQAAER LREENLELKKLLMSNGNKEGASGRPGSPKMEGTGKKAVAGQQQASVTAGK VPEVVALGAPEKKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELR QKLADLQKQVTDLEAEREQKQRDFDRKLLLAKSKIEMEETDKEQLTAEAK ELRQKVKYLQDQLSPLTRQRIQTPPSSPPTAFGSPEGAGALLRKQELVTQ NELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLSNAQL KAFKDEEKAREALRQQKRKAKASGERYHVEPHPEHLCGAYPYAYPPMPAM VPHHGFEDWSQIRYPPPPMAMEHPPPLPNSRLFHLPEYTWRLPCGGVRNP NQSSQVMDPPTARPTEPESPKNDREGPQ*
Antibiotic:
Amp
Comments:
N ter FLAG for mammalian expression Estimated MW of expressed protein : 70884 Daltons

Do you need any help? Please get in touch and we’ll be happy to lend a hand.