cDNA Clone - ABIN1

Name: ABIN1
Price per aliquot: £110.00
Expressed:
GST-ABIN1 L490P
Plasmid:
pGEX6P-1-ABIN1 L490P
Parent Plasmid:
pGEX6P1
View Parent Plasmid

Snapgene File | Genbank File
ACGTTATCGACTGCACGGTGCACCAATGCTTCTGGCGTCAGGCAGCCATCGGAAGCTGTGGTATGGCTGTGCAGGTCGTAAATCACTGCATAATTCGTGTCGCTCAAGGCGCACTCCCGTTCTGGATAATGTTTTTTGCGCCGACATCATAACGGTTCTGGCAAATATTCTGAAATGAGCTGTTGACAATTAATCATCGGCTCGTATAATGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGTATTCATGTCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCACTCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATGAGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTGGAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACAGTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTGGTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTGGATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAACTCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCGAAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCATCCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCCAATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTGAAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCATGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCCAAAATCGGATCTGGAAGTTCTGTTCCAGGGGCCCCTGGGATCCCCGGAATTCCCGGGTCGACTCGAGCGGCCGCATCGTGACTGACTGACGATCTGCCTCGCGCGTTTCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACGGTCACAGCTTGTCTGTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGGCGCGTCAGCGGGTGTTGGCGGGTGTCGGGGCGCAGCCATGACCCAGTCACGTAGCGATAGCGGAGTGTATAATTCTTGAAGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGGTTTCTTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATAAATTCCGACACCATCGAATGGTGCAAAACCTTTCGCGGTATGGCATGATAGCGCCCGGAAGAGAGTCAATTCAGGGTGGTGAATGTGAAACCAGTAACGTTATACGATGTCGCAGAGTATGCCGGTGTCTCTTATCAGACCGTTTCCCGCGTGGTGAACCAGGCCAGCCACGTTTCTGCGAAAACGCGGGAAAAAGTGGAAGCGGCGATGGCGGAGCTGAATTACATTCCCAACCGCGTGGCACAACAACTGGCGGGCAAACAGTCGTTGCTGATTGGCGTTGCCACCTCCAGTCTGGCCCTGCACGCGCCGTCGCAAATTGTCGCGGCGATTAAATCTCGCGCCGATCAACTGGGTGCCAGCGTGGTGGTGTCGATGGTAGAACGAAGCGGCGTCGAAGCCTGTAAAGCGGCGGTGCACAATCTTCTCGCGCAACGCGTCAGTGGGCTGATCATTAACTATCCGCTGGATGACCAGGATGCCATTGCTGTGGAAGCTGCCTGCACTAATGTTCCGGCGTTATTTCTTGATGTCTCTGACCAGACACCCATCAACAGTATTATTTTCTCCCATGAAGACGGTACGCGACTGGGCGTGGAGCATCTGGTCGCATTGGGTCACCAGCAAATCGCGCTGTTAGCGGGCCCATTAAGTTCTGTCTCGGCGCGTCTGCGTCTGGCTGGCTGGCATAAATATCTCACTCGCAATCAAATTCAGCCGATAGCGGAACGGGAAGGCGACTGGAGTGCCATGTCCGGTTTTCAACAAACCATGCAAATGCTGAATGAGGGCATCGTTCCCACTGCGATGCTGGTTGCCAACGATCAGATGGCGCTGGGCGCAATGCGCGCCATTACCGAGTCCGGGCTGCGCGTTGGTGCGGATATCTCGGTAGTGGGATACGACGATACCGAAGACAGCTCATGTTATATCCCGCCGTCAACCACCATCAAACAGGATTTTCGCCTGCTGGGGCAAACCAGCGTGGACCGCTTGCTGCAACTCTCTCAGGGCCAGGCGGTGAAGGGCAATCAGCTGTTGCCCGTCTCACTGGTGAAAAGAAAAACCACCCTGGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGGATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCGCTTTGCCTGGTTTCCGGCACCAGAAGCGGTGCCGGAAAGCTGGCTGGAGTGCGATCTTCCTGAGGCCGATACTGTCGTCGTCCCCTCAAACTGGCAGATGCACGGTTACGATGCGCCCATCTACACCAACGTAACCTATCCCATTACGGTCAATCCGCCGTTTGTTCCCACGGAGAATCCGACGGGTTGTTACTCGCTCACATTTAATGTTGATGAAAGCTGGCTACAGGAAGGCCAGACGCGAATTATTTTTGATGGCGTTGGAATT
DU Number:
DU8696
Genbank:
Species:
Human
Synonyms:
TNIP1
Sequence of Insert:
View Sequence

GGATCCATGGAAGGGAGAGGACCGTACCGGATCTACGACCCTGGGGGCAG CGTGCCCTCAGGAGAGGCATCCGCAGCTTTTGAGCGCCTAGTGAAGGAGA ATTCCCGGCTGAAGGAAAAAATGCAAGGGATAAAGATGTTAGGGGAGCTT TTGGAAGAGTCCCAGATGGAAGCGACCAGGCTCCGGCAGAAGGCAGAGGA GCTAGTGAAGGACAACGAGCTGCTCCCACCACCTTCTCCCTCCTTGGGCT CCTTCGACCCCCTGGCTGAGCTCACAGGAAAGGACTCAAATGTCACAGCA TCTCCCACAGCCCCTGCATGCCCCAGTGACAAGCCAGCACCAGTCCAGAA GCCTCCATCCAGTGGCACCTCCTCTGAATTTGAAGTGGTCACTCCTGAGG AGCAGAATTCACCAGAGAGCAGCAGCCATGCCAATGCGATGGCGCTGGGC CCCCTGCCCCGTGAGGACGGCAACCTGATGCTGCACCTGCAGCGCCTGGA GACCACGCTGAGTGTGTGTGCCGAGGAGCCGGACCACGGCCAGCTCTTCA CCCACCTGGGCCGCATGGCCCTGGAGTTCAACCGACTGGCATCCAAGGTG CACAAGAATGAGCAGCGCACCTCCATTCTGCAGACCCTGTGTGAGCAGCT TCGGAAGGAGAACGAGGCTCTGAAGGCCAAGTTGGATAAGGGCCTGGAAC AGCGGGATCAGGCTGCCGAGAGGCTGCGGGAGGAAAATTTGGAGCTCAAG AAGTTGTTGATGAGCAATGGCAACAAAGAGGGTGCGTCTGGGCGGCCAGG CTCACCGAAGATGGAAGGGACAGGCAAGAAGGCAGTGGCTGGACAGCAGC AGGCTAGTGTGACGGCAGGTAAGGTCCCAGAGGTGGTGGCCTTGGGCGCA CCCGAGAAGAAGGTGAAGATGCTGGAGCAGCAGCGCAGTGAGCTGCTGGA AGTGAACAAGCAGTGGGACCAGCATTTCCGGTCCATGAAGCAGCAGTATG AGCAGAAGATCACTGAGCTGCGTCAGAAGCTGGCTGATTTGCAGAAGCAG GTGACTGACCTGGAGGCCGAGCGGGAGCAGAAGCAGCGTGACTTTGACCG CAAGCTCCTCCTGGCCAAGTCCAAGATTGAAATGGAGGAGACCGACAAGG AGCAGCTGACAGCAGAGGCCAAGGAGCTGCGCCAAAAGGTCAAGTACCTG CAGGATCAGCTGAGCCCACTCACCCGACAGCGTGAGTACCAGGAAAAGGA GATCCAGCGGCTCAACAAGGCCCTGGAGGAAGCACTGAGCATCCAAACCC CGCCATCATCTCCACCAACAGCATTTGGGAGCCCAGAAGGAGCAGGGGCC CTCCTAAGGAAACAGGAGCTGGTCACGCAGAATGAGTTGCTGAAACAGCA GGTGAAGATCTTCGAGGAGGACTTCCAGAGGGAGCGCAGTGATCGTGAGC GCATGAATGAGGAGAAGGAAGAGCCGAAGAAGCAAGTGGAGAAGCTGCAG GCCCAGGTCACCCTGTCAAATGCCCAGCTAAAAGCATTCAAAGATGAGGA GAAGGCAAGAGAAGCCCTCAGACAGCAGAAGAGGAAAGCAAAGGCCTCAG GAGAGCGTTACCATGTGGAGCCCCACCCAGAACATCTCTGCGGGGCCTAC CCCTACGCCTACCCGCCCATGCCAGCCATGGTGCCACACCATGGCTTCGA GGACTGGTCCCAGATCCGCTACCCCCCTCCCCCCATGGCCATGGAGCACC CGCCCCCACTCCCCAACTCGCGCCTCTTCCATCTGCCGGAATACACCTGG CGTCTACCTTGTGGAGGGGTTCGAAATCCAAATCAGAGCTCCCAAGTGAT GGACCCTCCCACAGCCAGGCCTACAGAACCAGAGTCTCCAAAAAATGACC GTGAGGGGCCTCAGTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMEGRGPYRIYDPGGSVPSG EASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKD NELLPPPSPSLGSFDPLAELTGKDSNVTASPTAPACPSDKPAPVQKPPSS GTSSEFEVVTPEEQNSPESSSHANAMALGPLPREDGNLMLHLQRLETTLS VCAEEPDHGQLFTHLGRMALEFNRLASKVHKNEQRTSILQTLCEQLRKEN EALKAKLDKGLEQRDQAAERLREENLELKKLLMSNGNKEGASGRPGSPKM EGTGKKAVAGQQQASVTAGKVPEVVALGAPEKKVKMLEQQRSELLEVNKQ WDQHFRSMKQQYEQKITELRQKLADLQKQVTDLEAEREQKQRDFDRKLLL AKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRL NKALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIF EEDFQRERSDRERMNEEKEEPKKQVEKLQAQVTLSNAQLKAFKDEEKARE ALRQQKRKAKASGERYHVEPHPEHLCGAYPYAYPPMPAMVPHHGFEDWSQ IRYPPPPMAMEHPPPLPNSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPT ARPTEPESPKNDREGPQ*
Antibiotic:
Amp
Comments:
N ter GST for bacterial expression. Estimated MW of expressed protein : 98695 Daltons

Do you need any help? Please get in touch and we’ll be happy to lend a hand.