Polyclonal Antibody - RAB8A

Name: RAB8A
Price per aliquot (100µg): £110.00
Full Name:
RAB8A (172 - 203)
Long Name Text:
RAB8A, member RAS oncogene family
Immuno Sequence:
CKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFR [residues 172 - 203 of human]
Sheep Number:
S969D
Monoclonal/Polyclonal:
Polyclonal
Gel Image:

Figure One - Lysates of A549 WT cells and A549 Rab8A KO cells, 20 µg of protein was loaded per lane. The antibodies were used in 5% milk in TBST at 1 ug/ml. The membranes were incubated with the antibodies overnight in 4°C. The secondary sheep antibody conjugated with HRP was used in 5% milk in TBST for 1 hour at RT. Figure Two - For IP with S969D 200 µg of Ab was coupled with 1000 µl of crude beads and then 30 µl of beads used per 1 mg of protein. IP was performed for 3 h at 4°C. Lysates of A549 WT and A549 Rab8A KO were used.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.