COVID-19 CLOSURE

COVID-19 Closure

Due to the current situation with Covid 19 this facility is currently closed and all staff are working from home. Although we will be checking emails regularly, there may be a longer delay than usual in replying.

Substrate Peptides

Name Peptide Sequence Substrate For Derived from Price per aliquot (1mg) Add to cart
STK33 Substrate Peptide AALVRQMSVAFFFKKKKK STK33 - £20.00
CaMKK Substrate Peptide AKPKGNKDYHLQTCCGSLAYRRR CaMKK MELK-derived peptide £20.00
Sakamototide ALNRTSSDSALHRRR AMPK, SIK CRTC2 derived peptide £20.00
AMARA peptide AMARAASAAALARRR AMPK - £20.00
PIMtide ARKRRRHPSGPPTA PIM consensus peptide substrate £20.00
ABLtide EAIYAAPFAKKK ABL synthetic peptide substrate £20.00
Lyntide EFPIYDFLPAKKK Lyn, TEC - £20.00
Generic Protein Kinase Substrate ERMRPRKRQGSVRRRV Generic Substrate, PKC corresponds to pseudosubstrate region of the e-isotype of protein kinase C (PKCe) with an alanine to serine substitution £20.00
LKB1 Substrate Peptide FGNFYKSGEPLSTWCGSPPYRRR LKB1 - £20.00
CDK7tide FLAKSFGSPNRAYKK CHK7, NEK6, NEK7 CDK7 derived peptide £20.00
Srctide GEEPLYWSFPAKKK SRC, ITK, cKIT, LCK - £20.00
HER2 Substrate Peptide GGMEDIYFEFMGGKKK HER2, cKIT, TIE2 identified by screening a degenerate peptide library £20.00
Crosstide GRPRTSSFAEG PKB, MSK, p70 S6K, SGK glycogen synthase kinase 3 (GSK3) derived peptide £20.00
SAMS peptide HMRSAMSGLHLVKRR AMPK acetyl-CoA carboxylase derived peptide £20.00
PLK Substrate Peptide ISDELMDATFADQEAKKK PLK1 - £20.00
Long S6 KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK RSK1, PRK2, ROCK S6 derived peptide £20.00
ULK1 Substrate Peptide KKAGAGSGQLIDSMANSFVGTR ULK1 - £20.00
WOODtide KKISGRLSPIMTEQ DYRK Forkhead derived peptide £20.00
IKK, TBK1 Substrate Peptide KKKERLLDDRHDSGLDSMKDEE IKK, TBK1 IkappaB alpha derived peptide £20.00
CSKtide KKKKEEIYFFFG CSK, PDGFR, AXL - £20.00
IGF1Rtide KKKSPGEYVNIEFG IGF1R, FGFR1 IRS-1 derived peptide £20.00
CHKtide KKKVSRSGLYRSPSMPENLNRPR CHK1, BRSK1, SIK CDC25C derived peptide £20.00
ZIPtide KKLNRTLSFAEPG DAPK1. BRSK2, VEGFR - £20.00
PRAKtide KKLNRTLSVA MAPKAP-K2, CaMK4, PKD1 Glycogen Synthase derived peptide £20.00
Generic Protein Kinase Substrate KKLSLQRSSSFKDFA Generic Substrate - £20.00
p70 S6 Kinase Substrate Peptide KKRNRTLTV p70 S6 kinase - £20.00
MLCK Substrate Peptide KKRPQRATSNVFA MLCK myosin regulatory light chain derived peptide £20.00
AXLtide KKSRGDYMTMQIG AXL, DDR2, INSRR Insulin receptor substrate 1 derived peptide £20.00
PhKtide KRKQISVRGL Phosphorylase Kinase glycogen phosphorylase derived peptide £20.00
CK1 Substrate Peptide KRRRALS(phospho)VASLPGL CK1 glycogen synthase derived peptide £20.00
PDKtide [protein fragment, 39 aa] PDK1, JAK2 residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984) £20.00
Tyrosine Kinase Peptide 1 KVEKIGEGTYGVVYK BRK, LCK, CSK, Src CDC2 derived peptide £20.00
IKK Substrate Peptide LDDRHDSGLDSMKDEEY IKK IkappaB alpha derived peptide £20.00
KEMPtide LRRASLG PKA - £20.00
Aurora Substrate Peptide LRRLSLGLRRLSLGLRRLSLGLRRLSLG Aurora - £20.00
LBKtide LSNLYHQGKFLQTFCGSPLYRRR LBK1 NUAK2 derived peptide £20.00
Generic Protein Kinase Substrate LSNMNSDGEFLRTSCGSPNYRRR Generic Substrate - £20.00
Generic Protein Kinase Substrate RARTLSFAEPG Generic Substrate - £20.00
NEK2a Substrate Peptide RFRRSRRMI NEK2A - £20.00
EF2tide RKKFGESEKTKTKEFL EF2K dictyostelium myosin II heavy chain derived peptide £20.00
LRRKtide RLGRDKYKTLRQIRQ LRRK2, MAP4K3 Moesin derived peptide £20.00
CLK2 Substrate Peptide RNRYRDVSPFDHSR CLK2 - £20.00
GSK3 Substrate Peptide RRAAEELDSRAGS(phospho)PQL GSK3 eIF2B derived peptide £20.00
CATCHtide RRHYYYDTHTNTYYLRTFGHNTRR OSR1, SPAK NKCC1 derived peptide £20.00
CK1 Substrate Peptide RRKDLHDDEEDEAMSITA CK1 synthetic peptide substrate £20.00
TGFBR1 Substrate Peptide RRKVLTQMGSPSIRCSS(phospho)VS TGFBR1 SMAD derived peptide £20.00
Tyrosine Kinase Peptide 3 RRLIEDAEYAARG Generic Substrate pp60Src derived peptide £20.00
CK2 Substrate Peptide RRRDDDSDDD CK2 consensus phosphorylation sequence for CK2 £20.00
PAKtide RRRLSFAEPG PAKs, Aurora - £20.00
PIM Substrate Peptide RSRHSSYPAGT PIM - £20.00
SRPKtide RSRSRSRSRSRSRSR SRPK ASF1/SF-2 derived peptide £20.00
CaMK1 substrate peptide YLRRRLSDSNF CaMK1 Synapsin 1 derived peptide £20.00
Glycogen Synthase Peptide 2 (Ala 21) YRRAAVPPSPSLSRHSSPHQAEDEEE GSK3 Negative Control Glycogen synthase derived peptide £20.00
Glycogen Synthase Peptide 2 YRRAAVPPSPSLSRHSSPHQS(phospho)EDEEE GSK3 Glycogen synthase derived peptide £20.00
CDK7 CDK9 Substrate Peptide YSPTSPSYSPTSPSYSPTSPSKKK CDK7, CDK9 RNA polymerase II CTD derived peptide £20.00

Do you need any help? Please get in touch and we’ll be happy to lend a hand.