FESTIVE CLOSURE

Festive Closure

We will be closed between 21st December to 4th January. Orders may be placed during this time but will not be shipped until January 2018. Seasons Greetings to all our customers.

Antibodies

Displaying 301 - 350 of 498 available to order
Advanced options
Type Gene Name/Antigen Name Text Full Name Immuno Sequence Sheep No Type Price per aliquot (100µg) Add to cart
Antibodies PKB View Data Protein Kinase B PKB gamma (116 -127) RMNCSPTSQIDN [residues 116 - 127 of human] S697B Polyclonal Antibody £100.00
Antibodies PKB View Data Protein Kinase B PKB alpha His-PKB alpha S742B Polyclonal Antibody £100.00
Antibodies PRAK View Data p38-regulated/activated kinase PRAK phospho Thr 182 QGDLMT*PQFTP [residues 177 - 187 of human] S084A Polyclonal Antibody £100.00
Antibodies PRAS40 View Data 40 kDa proline-rich AKT substrate PRAS40 (238 - 256) DLPRPRLNTSDFQKLKRKY [residues 238 - 256 of human] S115B Polyclonal Antibody £100.00
Antibodies PROTOR View Data Protein observed with Rictor-1 PROTOR1 GST-PROTOR1 (1 - 388) [DU 10413] [Accession number NM_181333] - Originally named PRR5 S020C Polyclonal Antibody £100.00
Antibodies PTEN View Data PTEN phospho Thr 366 Phosphatase and tensin homolog TSVT*PDV [residues 363 - 369 of human] S663B Polyclonal Antibody £100.00
Antibodies PTEN View Data PTEN phospho Ser 370 Phosphatase and tensin homolog TPDVS*DNE [residues 366 - 373 of human] S570B Polyclonal Antibody £100.00
Antibodies RAB10 View Data RAB10 phospho Thr 73 AGQERFHT*ITTSYYR [residues 66 - 80 of human] S873D Polyclonal Antibody £100.00
Antibodies RAB10 View Data RAB10, member RAS oncogene family RAB10 (131 - 155) CTPVKEPNSENVDISSGGGVTGWKSK [residues 131 - 155 of human] S945D Polyclonal Antibody £100.00
Antibodies RAB12 View Data RAB12 phospho Ser 106 AGQERFNS*ITSAYYR [residues 99 - 113] S876D Polyclonal Antibody £100.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family Rab13 MBP-Rab13 [Du 43886] S806D Polyclonal Antibody £100.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family pseudogene Rab13 phospho Ser 111 KSIKENAS*AGVERLR [residues 104 - 117 of human] S505D Polyclonal Antibody £100.00
Antibodies RAB1A View Data RAB1A phospho Ser 114 CQEIDRYAS*ENVNKLR [residues 107 - 120 of human] S817D Polyclonal Antibody £100.00
Antibodies RAB1B View Data RAB1B phospho Ser 111 CQEIDRYAS*ENVNKLR [residues 104 - 118 of human] S817D Polyclonal Antibody £100.00
Antibodies RAB39B View Data RAB39B GST-RAB39B [DU 43849] S935D Polyclonal Antibody £100.00
Antibodies Rab7A View Data RAB7A GST-RAB7A (mouse) [DU 46688] S824D Polyclonal Antibody £100.00
Antibodies RAB7L View Data RAB7L phospho Thr 71 IAGQERFT*SMTRLYYR [residues 64 - 9 of human] S877D Polyclonal Antibody £100.00
Antibodies RAB7L View Data RAB7L (1 - 203) His-SUMO-RAB7L (1 - 203) [DU 50291] S984D Polyclonal Antibody £100.00
Antibodies Rab8A View Data RAB8A, member RAS oncogene family Rab8A MBP-Rab8A [Du 16222] S804D Polyclonal Antibody £100.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A phospho Thr 72 AGQERFRT*ITTAYYR [residues 65 - 79 of human] S874D Polyclonal Antibody £100.00
Antibodies Rab8a View Data RAB8A, member RAS oncogene family Rab8a phospho Ser 111 RNIEEHAS*ADVEKMR [residues 104 - 117 of human] S503D Polyclonal Antibody £100.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A (172 - 203) CKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFR [residues 172 - 203 of human] S969D Polyclonal Antibody £100.00
Antibodies Rab8b View Data RAB8B, member RAS oncogene family Rab8b phospho Ser 111 RNIEEHAS*SDVERMR [residues 104 - 117 of human] S504D Polyclonal Antibody £100.00
Antibodies Rab8B View Data RAB8B, member RAS oncogene family Rab8B MBP-Rab8B [Du 43885] S805D Polyclonal Antibody £100.00
Antibodies RanBP2 View Data RAN binding protein 2 GST-RanBP2 (2553 - 2838) GST-RanBP2 (2553 - 2838) [DU 41169] S363D Polyclonal Antibody £100.00
Antibodies RAP1GAP2 View Data RAP1 GTPase activating protein 2 RAP1GAP2 (260 - 480) GST-RAP1GAP2 (260 - 480) [DU 41252] S376D Polyclonal Antibody £100.00
Antibodies Raptor View Data Regulatory Associated Protein Of MTOR Raptor (1 - 20) MESEMLQSPLLGLGEEDEAD [residues 1 - 20 of human] S260D Polyclonal Antibody £100.00
Antibodies REEP1 View Data Receptor Accessory Protein 1 GST-REEP1 (65 - end) GST-REEP1 (65 - end) [DU 31162] S280D Polyclonal Antibody £100.00
Antibodies REEP2 View Data Receptor Accessory Protein 2 GST-REEP2 (169 - end) GST-REEP2 (169 - end) [DU 40147] S301D Polyclonal Antibody £100.00
Antibodies REEP4 View Data Receptor Accessory Protein 4 GST-REEP4 (65 - end) GST-REEP4 (65 - end) [DU 36488] S281D Polyclonal Antibody £100.00
Antibodies REPS1 View Data RALBP1 Associated Eps Domain Containing 1 REPS1 phospho Ser 537 VTRQRSHS*GTSPDNT [residues 530 - 544 of human] S249D Polyclonal Antibody £100.00
Antibodies Ribosomal S6 protein View Data Ribosomal S6 protein Ribosomal S6 protein phospho Ser 235 AKRRRKS*SLRASTS [residues 229 - 242 of human] S441A Polyclonal Antibody £100.00
Antibodies Rictor View Data rapamycin-insensitive companion of mTOR Rictor (6 - 20) RGRSLKNLRVRGRND [residues 6 – 20 of human] S654B Polyclonal Antibody £100.00
Antibodies RNF12 View Data RNF12 (mouse) GST-RNF12 (mouse) [DU 49041] S708D Polyclonal Antibody £100.00
Antibodies RNF12 View Data RNF12 (1 - 271 mouse) GST-RNF12 (1 - 271 mouse) [DU 49042] S691D Polyclonal Antibody £100.00
Antibodies RNF7 View Data Ring Finger Protein 7 RNF7 GST-RNF7 [DU 21923] S299D Polyclonal Antibody £100.00
Antibodies RSK2 (MAPKAP_K1) View Data MAPK-activated protein kinase-1 RSK2 (712 - 734) RNQSPVLEPVGRSTLAQRRGIKK [residues 712 - 734 of human] S382 Polyclonal Antibody £100.00
Antibodies RSK2 (MAPKAP_K1) View Data MAPK-activated protein kinase-1 RSK2 (712 - 734) RNQSPVLEPVGRSTLAQRRGIKK [residues 712 - 734 of human] S382 Polyclonal Antibody £100.00
Antibodies RTT101 View Data Regulator of Ty1 Transposition RTT101 (460 - 660) GST-RTT101 (460 - 660 S. cerevisiae) [DU 21754] S245D Polyclonal Antibody £100.00
Antibodies SAKS1 View Data SAKS1 phospho Ser 200 PGPVPS*SPSQEPP [residues 195 - 207 of human] S747A Polyclonal Antibody £100.00
Antibodies SAKS1 View Data SAKS1 GST-SAKS1 S736A Polyclonal Antibody £100.00
Antibodies SAP97 View Data Sin3A-associated protein SAP97 GST-SAP97 [DU 391] S552B Polyclonal Antibody £100.00
Antibodies SAP97 View Data Sin3A-associated protein SAP97 phospho Ser 431 DNHVS*PSSYLGQTPASPARYSPISK [residues 427 - 451 of rat] S938A Polyclonal Antibody £100.00
Antibodies SAP97 View Data Sin3A-associated protein SAP97 phospho Ser 158 VSHSHIS*PIK [residues 152 - 161 of human/rat] S285B Polyclonal Antibody £100.00
Antibodies SAP97 View Data Sin3A-associated protein SAP97 phospho Ser 442 DNHVSPSSYLGQTPAS*PARYSPISK [residues 427 - 451 of rat] S965A Polyclonal Antibody £100.00
Antibodies SAP97 View Data Sin3A-associated protein SAP97 phospho Thr 209 NTDSLET*PTYVNGT [residues 203 - 216 of human/rat] S937A Polyclonal Antibody £100.00
Antibodies SAPK4 View Data Stress-activated protein kinase SAPK4 GST-SAPK4 [DU 981] S526A Polyclonal Antibody £100.00
Antibodies SGK View Data Serum and glucocorticoid-induced kinase 1 SGK1 GST-SGK1 [DU 35257] S062D Polyclonal Antibody £100.00
Antibodies SGK View Data Serum and glucocorticoid-induced kinase 3 SGK3 (1-130) PX domain GST-SGK3 (1-130) [DU 2034] S037D Polyclonal Antibody £100.00
Antibodies SGK View Data Serum and glucocorticoid-induced kinase 2 SGK2 (333-346) KSIGCTPDTVASSS [residues 333-346 of human] S036D Polyclonal Antibody £100.00

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.