Polyclonal Antibodies

Displaying 401 - 450 of 620 available to order
Type Gene Name/Antigen Name Text Full Name Immuno Sequence Sheep No Type Price per aliquot (100µg) Add to cart
Antibodies RAB12 View Data RAB12 phospho Ser 106 AGQERFNS*ITSAYYR [residues 99 - 113] S876D Polyclonal Antibody £110.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family Rab13 MBP-Rab13 [Du 43886] S806D Polyclonal Antibody £110.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family pseudogene Rab13 phospho Ser 111 KSIKENAS*AGVERLR [residues 104 - 117 of human] S505D Polyclonal Antibody £110.00
Antibodies RAB1A View Data RAB1A phospho Ser 114 CQEIDRYAS*ENVNKLR [residues 107 - 120 of human] S817D Polyclonal Antibody £110.00
Antibodies RAB1B View Data RAB1B phospho Ser 111 CQEIDRYAS*ENVNKLR [residues 104 - 118 of human] S817D Polyclonal Antibody £110.00
Antibodies RAB35 View Data RAB35 GST-RAB35 [DU 26867] SA314 Polyclonal Antibody £110.00
Antibodies Rab35 View Data RAB35 phospho Thr 72 AGQERFRT*ITSTYYR [residues 65 - 79 of human] SA083 Polyclonal Antibody £110.00
Antibodies RAB39B View Data RAB39B GST-RAB39B [DU 43849] S935D Polyclonal Antibody £110.00
Antibodies Rab3A View Data RAB3A phospho Thr 86 AGQERYRT*ITTAYYR [residues 79 - 93 of human] SA082 Polyclonal Antibody £110.00
Antibodies RAB43 View Data RAB43 GST-RAB43 [DU 50329] SA135 Polyclonal Antibody £110.00
Antibodies RAB43 View Data RAB43 phospho Thr 82 CAGQERFRT*ITQSYYR [residues 75 - 89 of human] SA334 Polyclonal Antibody £110.00
Antibodies RAB5A View Data RAB5A, member RAS oncogene family RAB5A phospho Ser 84 AGQERYHS*LAPMYYR [residues 77 - 91 of human] S942D Polyclonal Antibody £110.00
Antibodies Rab7A View Data RAB7A GST-RAB7A (mouse) [DU 46688] S824D Polyclonal Antibody £110.00
Antibodies RAB7A View Data RAB7A phospho Ser 72 AGQERFQS*LGVAFYR [residues 65 - 79 of human] S875D Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L phospho Ser 72 DIAGQERFTS*MTRLYYRSS [residues 63 - 91 of human] SA136 Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L phospho Thr 71 IAGQERFT*SMTRLYYR [residues 64 - 9 of human] S877D Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L (1 - 203) His-SUMO-RAB7L (1 - 203) [DU 50291] S984D Polyclonal Antibody £110.00
Antibodies Rab8A View Data RAB8A, member RAS oncogene family Rab8A MBP-Rab8A [Du 16222] S804D Polyclonal Antibody £110.00
Antibodies Rab8a View Data RAB8A, member RAS oncogene family Rab8a phospho Ser 111 RNIEEHAS*ADVEKMR [residues 104 - 117 of human] S503D Polyclonal Antibody £110.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A phospho Thr 72 AGQERFRT*ITTAYYR [residues 65 - 79 of human] S874D Polyclonal Antibody £110.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A (172 - 203) CKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFR [residues 172 - 203 of human] S969D Polyclonal Antibody £110.00
Antibodies Rab8B View Data RAB8B, member RAS oncogene family Rab8B MBP-Rab8B [Du 43885] S805D Polyclonal Antibody £110.00
Antibodies Rab8b View Data RAB8B, member RAS oncogene family Rab8b phospho Ser 111 RNIEEHAS*SDVERMR [residues 104 - 117 of human] S504D Polyclonal Antibody £110.00
Antibodies RanBP2 View Data RAN binding protein 2 GST-RanBP2 (2553 - 2838) GST-RanBP2 (2553 - 2838) [DU 41169] S363D Polyclonal Antibody £110.00
Antibodies RAP1GAP2 View Data RAP1 GTPase activating protein 2 RAP1GAP2 (260 - 480) GST-RAP1GAP2 (260 - 480) [DU 41252] S376D Polyclonal Antibody £110.00
Antibodies Raptor View Data Regulatory Associated Protein Of MTOR Raptor (1 - 20) MESEMLQSPLLGLGEEDEAD [residues 1 - 20 of human] S260D Polyclonal Antibody £110.00
Antibodies RASSF7 View Data Ras association domain family member 7 RASSF7 phospho Ser 111 CKKRCLIRAS*LPVKPR [residues 105 - 117 of human] SA360 Polyclonal Antibody £110.00
Antibodies REEP1 View Data Receptor Accessory Protein 1 GST-REEP1 (65 - end) GST-REEP1 (65 - end) [DU 31162] S280D Polyclonal Antibody £110.00
Antibodies REEP2 View Data Receptor Accessory Protein 2 GST-REEP2 (169 - end) GST-REEP2 (169 - end) [DU 40147] S301D Polyclonal Antibody £110.00
Antibodies REEP4 View Data Receptor Accessory Protein 4 GST-REEP4 (65 - end) GST-REEP4 (65 - end) [DU 36488] S281D Polyclonal Antibody £110.00
Antibodies REPS1 View Data RALBP1 Associated Eps Domain Containing 1 REPS1 phospho Ser 537 VTRQRSHS*GTSPDNT [residues 530 - 544 of human] S249D Polyclonal Antibody £110.00
Antibodies Ribosomal S6 protein View Data Ribosomal S6 protein Ribosomal S6 protein phospho Ser 235 AKRRRKS*SLRASTS [residues 229 - 242 of human] S441A Polyclonal Antibody £110.00
Antibodies Rictor View Data rapamycin-insensitive companion of mTOR Rictor (6 - 20) RGRSLKNLRVRGRND [residues 6 – 20 of human] S654B Polyclonal Antibody £110.00
Antibodies RNF12 View Data ring finger protein, LIM domain interacting RNF12 phospho Ser 212 Ser 214 QRRARS*RS*PEHRR [residues 207 - 219 of human] SA310 Polyclonal Antibody £110.00
Antibodies RNF12 View Data RNF12 (mouse) GST-RNF12 (mouse) [DU 49041] S708D Polyclonal Antibody £110.00
Antibodies RNF12 View Data ring finger protein, LIM domain interacting RNF12 (1 - 271 mouse) GST-RNF12 (1 - 271 mouse) [DU 49042] S691D Polyclonal Antibody £110.00
Antibodies RNF7 View Data Ring Finger Protein 7 RNF7 GST-RNF7 [DU 21923] S299D Polyclonal Antibody £110.00
Antibodies RSK2 (MAPKAP_K1) View Data MAPK-activated protein kinase-1 RSK2 (712 - 734) RNQSPVLEPVGRSTLAQRRGIKK [residues 712 - 734 of human] S382 Polyclonal Antibody £110.00
Antibodies RTT101 View Data Regulator of Ty1 Transposition RTT101 (460 - 660) GST-RTT101 (460 - 660 S. cerevisiae) [DU 21754] S245D Polyclonal Antibody £110.00
Antibodies S Protein RBD domain SARS-CoV2 View Data SARS-CoV2 Spike Protein RBD domain Spike Protein RBD domain SARS-CoV2 MBP-SARS-CoV2 S Protein RBD [DU 67753] DA125 Polyclonal Antibody £110.00
Antibodies S Protein SARS-CoV2 View Data SARS-CoV2 Spike Protein Spike Protein SARS-CoV2 MBP-SARS-CoV2 S Protein [DU 67743] DA123 Polyclonal Antibody £110.00
Antibodies SAKS1 View Data SAKS1 phospho Ser 200 PGPVPS*SPSQEPP [residues 195 - 207 of human] S747A Polyclonal Antibody £110.00
Antibodies SAKS1 View Data SAKS1 GST-SAKS1 S736A Polyclonal Antibody £110.00
Antibodies SAP97 View Data Sin3A-associated protein SAP97 phospho Ser 442 DNHVSPSSYLGQTPAS*PARYSPISK [residues 427 - 451 of rat] S965A Polyclonal Antibody £110.00
Antibodies SAP97 View Data Sin3A-associated protein SAP97 phospho Thr 209 NTDSLET*PTYVNGT [residues 203 - 216 of human/rat] S937A Polyclonal Antibody £110.00
Antibodies SAP97 View Data Sin3A-associated protein SAP97 GST-SAP97 [DU 391] S552B Polyclonal Antibody £110.00
Antibodies SAP97 View Data Sin3A-associated protein SAP97 phospho Ser 431 DNHVS*PSSYLGQTPASPARYSPISK [residues 427 - 451 of rat] S938A Polyclonal Antibody £110.00
Antibodies SAP97 View Data Sin3A-associated protein SAP97 phospho Ser 158 VSHSHIS*PIK [residues 152 - 161 of human/rat] S285B Polyclonal Antibody £110.00
Antibodies SAPK4 View Data Stress-activated protein kinase SAPK4 GST-SAPK4 [DU 981] S526A Polyclonal Antibody £110.00
Antibodies SARS CoV HSZ-Cc E Protein View Data SARS CoV HSZ-Cc Envelope Protein SARS CoV HSZ-Cc Envelope Protein GST-SARS CoV HSZ-Cc E Protein [DU 68502] DA096 Polyclonal Antibody £110.00


Do you need any help? Please get in touch and we’ll be happy to lend a hand.